RRAD Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RRAD Polyclonal antibody, PBS Only (27763-1-PBS)

• 

  WB analysis using 27763-1-AP (same clone as 27763-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27763-1-AP (RRAD antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27763-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SKOV-3 using 27763-1-AP (same clone as 27763-1-PBS)

  WB result of RRAD antibody (27763-1-AP; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RRAD transfected SKOV-3 cells. This data was developed using the same antibody clone with 27763-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RRAD Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27763-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Ras associated with diabetes, RAD1, RAD, GTP-binding protein RAD, GTP binding protein RAD

---

Product Information

27763-1-PBS targets RRAD in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26869

  Product name: Recombinant human RRAD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 39-141 aa of BC057815

  Sequence: SMPVDERDLQAALTPGALTAAAAGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLM

• Full Name: Ras-related associated with diabetes
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 29-34 kDa
• GenBank Accession Number: BC057815
• Gene Symbol: RRAD
• Gene ID (NCBI): 6236
• RRID: AB_3085993
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55042
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RRAD is also named as RAD1. RRAD, a member of the Ras-like small GTPase family, was initially identified as a gene associated with Type II diabetes since it was found to be overexpressed in some Type II diabetic patients (PMID: 8248782). RRAD overexpression reduced insulin-stimulated glucose uptake in cultured muscle and adipocytes cells (PMID: 8798502). RRAD was found to be frequently down-regulated in different types of human cancers, including lung cancer, breast cancer, and nasopharyngeal carcinoma, etc, due to the hypermethylation of its promoter (PMID: 17195088).