RRP9 Polyclonal antibody

• 

  WB analysis using 10311-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10311-1-AP (RRP9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

RRP9 Polyclonal Antibody for WB, ELISA

Cat No. 10311-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

RNU3IP2, RRP9, RRP9 homolog, U3 55K, U355K

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10311-1-AP targets RRP9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0319

  Product name: Recombinant human RRP9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-215 aa of BC001113

  Sequence: MSATAAARKRGKPASGAGAGAGAGKRRRKADSAGDRGKSKGGGKMNEEISSDSESESLAPRKPEEEEEEELEETAQEKKLRLAKLYLEQLRQQEEEKAEARAFEEDQVAGRLKEDVLEQRGRLQKLVAKEIQAPASADIRVLRGHQLSITCLVVTPDDSAIFSAAKDCSIIKWSVESGRKLHVIPRAKKGAEGKPPGHSSHVLCMAISSDGKYLA

• Full Name: ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast)
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 52-55 kDa
• GenBank Accession Number: BC001113
• Gene Symbol: RRP9
• Gene ID (NCBI): 9136
• RRID: AB_2180765
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43818
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.