RS1 Monoclonal antibody, PBS Only

RS1 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68654-1-PBS
Clone No.1A2D4

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, mouse, rabbit

Applications

WB, Indirect ELISA

Retinoschisin, retinoschisin 1, RS, RS1, XLRS1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68654-1-PBS targets RS1 in WB, Indirect ELISA applications and shows reactivity with Human, rat, mouse, rabbit samples.

Tested Reactivity Human, rat, mouse, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18885

Product name: Recombinant human RS1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 25-224 aa of BC141638

Sequence: TEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA

Predict reactive species
Full Name retinoschisin 1
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC141638
Gene Symbol RS1
Gene ID (NCBI) 6247
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO15537
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RS1 is also named as XLRS1. RS1 can bind negatively charged membrane lipids, such as phosphatidylserine and phosphoinositides. RS1 is required for normal structure and function of the retina (PMID:19093009). It may play a role in cell-cell adhesion processes in the retina (PMID:27114531). RS1 is high expression in the retina (at protein level) (PMID:10915776, PMID:9326935). It is detected in the inner segment of the photoreceptors, the inner nuclear layer, the inner plexiform layer and the ganglion cell layer. At the macula, it is expressed in both the outer and inner nuclear layers and in the inner plexiform layer (PMID:10915776, PMID:10915776). And RS1 is undetectable in the inner plexiform layers and the inner nuclear layer (PMID:10915776)

Loading...
||
New chat

Able

正在加载,请稍候...