Use Able AI chat for product recommendations

RSAD2 Recombinant monoclonal antibody, PBS Only (Capture)

RSAD2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 83563-2-PBS
Clone No.240562F12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

S-adenosylmethionine-dependent nucleotide dehydratase RSAD2, Radical S-adenosyl methionine domain-containing protein 2, EC:4.2.-.-, Cytomegalovirus-induced gene 5 protein, CIG5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83563-2-PBS targets RSAD2 as part of a matched antibody pair:

MP00546-1: 83563-2-PBS capture and 83563-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27733

Product name: Recombinant human RSAD2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 181-361 aa of BC017969

Sequence: DSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW

Predict reactive species
Full Name radical S-adenosyl methionine domain containing 2
Calculated Molecular Weight 361 aa, 42 kDa
GenBank Accession NumberBC017969
Gene Symbol RSAD2
Gene ID (NCBI) 91543
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8WXG1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RSAD2 (radical S-adenosyl methionine domain-containing protein 2), also known as CIG5 (cytomegalovirus-induced gene 5 protein), vig1, viperin or CIG33, displays antiviral effect against HIV-1 virus, hepatitis C virus, human cytomegalovirus, and aphaviruses. Expression of the protein can be induced by interferon.

Loading...
||
New chat

Able

正在加载,请稍候...