RSL1D1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RSL1D1 Polyclonal antibody, PBS Only (27667-1-PBS)

• 

  WB analysis using 27667-1-AP (same clone as 27667-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27667-1-AP (RSL1D1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27667-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27667-1-AP (same clone as 27667-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27667-1-AP (RSL1D1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27667-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27667-1-AP (same clone as 27667-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27667-1-AP (RSL1D1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27667-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 27667-1-AP (same clone as 27667-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27667-1-AP (RSL1D1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27667-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 27667-1-AP (same clone as 27667-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27667-1-AP (RSL1D1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27667-1-PBS in a different storage buffer formulation.

RSL1D1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27667-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

27667-1-PBS targets RSL1D1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24923

  Product name: Recombinant human RSL1D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 269-490 aa of BC112228

  Sequence: SNWDEATKRSLLNKKKKEARRKRRERNFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTVKKPESKKEQTPEHGKKKRGRGKAQVKATNESEDEIPQLVPIGKKTPANEKVEIQKHATGKKSPAKSPNPSTPRGKKRKALPASETPKAAESETPGKSPEKKPKIKEEAVKEKSPSLGKKDARQTPKKPEAKFFTTPSKSVRKASHTPKKWPKKPKVPQST

• Full Name: ribosomal L1 domain containing 1
• Calculated Molecular Weight: 490 aa, 55 kDa
• Observed Molecular Weight: 55-70 kDa
• GenBank Accession Number: BC112228
• Gene Symbol: RSL1D1
• Gene ID (NCBI): 26156
• RRID: AB_3085982
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O76021
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RL1D1, Ribosomal L1 domain-containing protein 1, also named CSIG, a member of the universal ribosomal protein uL1 family. RL1D1 regulates cellular senescence through inhibition of PTEN translation. It acts as a pro-apoptotic regulator in response to DNA damage (PMID: 18678645, PMID: 22419112). RSL1D1 promoted the progression of colorectal cancer through RAN-mediated autophagy suppression. RSL1D1 can be detected 70 kDa (PMID:35013134).