Use Able AI chat for product recommendations

RSPH9 Polyclonal antibody

RSPH9 Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

C6orf206, CILD12, MRPS18AL1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RSPH9 in ?

Tested Applications

Positive WB detected inmouse testis tissue, NIH/3T3 cells, rat testis tissue
Positive IHC detected inrat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23253-1-AP targets RSPH9 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19745

Product name: Recombinant human RSPH9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-276 aa of BC029519

Sequence: MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML

Predict reactive species
Full Name radial spoke head 9 homolog (Chlamydomonas)
Calculated Molecular Weight 276 aa, 31 kDa
Observed Molecular Weight 31-35 kDa
GenBank Accession NumberBC029519
Gene Symbol RSPH9
Gene ID (NCBI) 221421
RRIDAB_2879240
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ9H1X1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RSPH9 (Radial Spoke Head 9 Homolog) is a protein involved in the structure and function of cilia and flagella. Cilia and flagella are hair-like structures that extend from the surface of many eukaryotic cells and play critical roles in cell motility, sensory perception, and signaling. The RSPH9 protein is a component of the radial spoke, a structure within the axoneme (the core of cilia and flagella) that is essential for the regulation of ciliary and flagellar movement.

Protocols

Product Specific Protocols
IHC protocol for RSPH9 antibody 23253-1-APDownload protocol
WB protocol for RSPH9 antibody 23253-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The RSPH9 Polyclonal antibody (Cat# 23253-1-AP) has 13 citations published across 12 journals including Cell, Science Advances, EBioMedicine, Cell Reports, Cell Molecular Life Sciences, Human Reproduction, Human Molecular Genetics, European Journal of Human Genetics, Asian Journal of Andrology, Science China Life Sciences, Biology Open, and eLife. The research fields center on cilia/flagella biology, radial spoke assembly, sperm flagellar defects, male infertility genetics, and ciliary gene-associated congenital diseases.

SpeciesApplicationTitle
humanIF

Cell

Structures of sperm flagellar doublet microtubules expand the genetic spectrum of male infertility

Authors - Lunni Zhou
mouseIF

Sci Adv

Loss-of-function variants in ciliary genes confer high risk for tetralogy of Fallot.

Authors - Yan Zhou
mouseWB

EBioMedicine

CFAP70 is a solid and valuable target for the genetic diagnosis of oligo-astheno-teratozoospermia in infertile men

Authors - Hui-Juan Jin
mouseWB,IF

Sci China Life Sci

Adenylate kinase phosphate energy shuttle underlies energetic communication in flagellar axonemes

Authors - Huan Wu
mouseWB,IF

Cell Rep

Differential requirements of IQUB for the assembly of radial spoke 1 and the motility of mouse cilia and flagella

Authors - Xin Zhang
humanIF

Hum Reprod

CALR3 defects disrupt sperm-zona pellucida binding in humans: new insights into male factor fertilization failure and relevant clinical therapeutic approaches

Authors - Yang Gao

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for this product is from Célia Tebbakh (October 2024), who used it for immunofluorescence on spermatozoa at a 1:100 dilution. She confirmed it works well but noted the concentration was slightly high, suggesting 1:200 would also be suitable. She gave the product a 5-star rating.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Célia (Verified Customer) (10-28-2024)

I tested 1/100 to be sure that it works in IF but the concentration was a little high so 1/200 should still be fine.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/100
  • Cell Tissue Type: Spermatozoa
Loading...
||
New chat

Able™

正在加载,请稍候...