RSPO1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RSPO1 Recombinant monoclonal antibody (86039-2-RR)

RSPO1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86039-2-RR

Clone No.260366B9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CRISTIN3, hRspo1, R spondin 1, Roof plate specific spondin 1, Roof plate-specific spondin-1

• 

  WB analysis using 86039-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86039-2-RR (RSPO1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: OVCAR-3 cells, SH-SY5Y cells, SKOV-3 cells, Daudi cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86039-2-RR targets RSPO1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21858

  Product name: Recombinant human RSPO1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-263 aa of BC114966

  Sequence: MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

• Full Name: R-spondin homolog (Xenopus laevis)
• Calculated Molecular Weight: 263 aa, 29 kDa
• Observed Molecular Weight: 28-38 kDa
• GenBank Accession Number: BC114966
• Gene Symbol: RSPO1
• Gene ID (NCBI): 284654
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q2MKA7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RSPO1, also named R-spondin-1, Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential role in ovary determination. Regulates Wnt signaling by antagonizing DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1. RSPO1 seems to mainly localize to nucleoli (PMID:17804805).