Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

RSPO3 Polyclonal antibody

RSPO3 Polyclonal Antibody for WB, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

CRISTIN1, hPWTSR, hRspo3, Protein with TSP type 1 repeat, Protein with TSP type-1 repeat

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RSPO3 in ?

Tested Applications

Positive WB detected inmouse small intestine tissue, Transfected HEK-293 cells
Positive IP detected inhuman placenta tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17193-1-AP targets RSPO3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9899

Product name: Recombinant human RSPO3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 27-272 aa of BC022367

Sequence: GRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH

Predict reactive species
Full Name R-spondin 3 homolog (Xenopus laevis)
Calculated Molecular Weight 272 aa, 31 kDa
Observed Molecular Weight 30-40 kDa
GenBank Accession NumberBC022367
Gene Symbol RSPO3
Gene ID (NCBI) 84870
RRIDAB_2878360
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BXY4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RSPO3, also named as R-spondin-3, is a 272 amino acid protein, which contains 1 TSP type-1 domain and 2 FU (furin-like) repeats. RSPO3 may be a secreted protein and belongs to the R-spondin family. RSPO3 is expressed at higher level in placenta, small intestine, fetal thymus and lymph node. RSPO3 is an activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. The four R-spondins (RSPO1-4) and three related leucinerich repeat-containing G-protein coupled receptors, LGR4, LGR5, and LGR6 (LGR4-6), constitute a ligand-receptor system that plays critical roles in development, stem cell survival, and oncogenesis. Ectopic expression of RSPO2/3in mouse mammary epithelial cells led to an increase in invasiveness in vitro and in tumor formation and metastasis in vivo.

Protocols

Product Specific Protocols
IP protocol for RSPO3 antibody 17193-1-APDownload protocol
WB protocol for RSPO3 antibody 17193-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-RSPO3 antibody (Cat# 17193-1-AP) has 19 citations published in journals including Nature, Cancer Discovery, Nature Communications, PNAS, Cardiovascular Research, and Cell Death & Disease. Research fields span Wnt signaling, tumor microenvironment and immunotherapy, liver zonation, cardiovascular disease, neuroprotection, diabetes-related vascular injury, wound healing, osteogenesis, gastric cancer, skeletal muscle regeneration, preeclampsia, and inflammatory arthritis.

SpeciesApplicationTitle
mouseWB

Nature

Hepatic stellate cells control liver zonation, size and functions via R-spondin 3

Authors - Atsushi Sugimoto
humanWB,IHC

Cancer Discov

Tumor Microenvironment-Derived R-spondins Enhance Antitumor Immunity to Suppress Tumor Growth and Sensitize for Immune Checkpoint Blockade Therapy

Authors - Yuting Tang
mouseWB

Nat Commun

R-Spondin chromosome rearrangements drive Wnt-dependent tumour initiation and maintenance in the intestine.

Authors - Teng Han
humanIHC

J Exp Clin Cancer Res

Subtypes in pancreatic ductal adenocarcinoma based on niche factor dependency show distinct drug treatment responses.

Authors - Tomohiko Shinkawa
humanWB

Cardiovasc Res

Role of R-spondin 2 in arterial lymphangiogenesis and atherosclerosis.

Authors - Bhupesh Singla
mouseWB,IF

Cell Death Dis

Endothelial cell-derived RSPO3 activates Gαi1/3-Erk signaling and protects neurons from ischemia/reperfusion injury

Authors - Ting-Tao Liu
  • KD Validated

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer reported excellent performance in Western Blot at a 1:250 dilution, noting a clear band at the expected molecular weight that confirmed successful transfection. The product received a 5-star rating.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Gerald (Verified Customer) (07-23-2025)

Worked very well for Western Blot, showing a clear band at the expected molecular weight size, thereby confirming a successful transfection.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/250
RSPO3 Antibody Western Blot validation (1/250 dilution) in (Cat no:17193-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...