RTCB Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86258-5-RR (same clone as 86258-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86258-5-RR (C22orf28 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86258-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86258-5-RR

  Biolayer interferometry (BLl) kinetic assays of 86258-5-RR against Human RTCB were performed. The affinity constant is below 1 pM.

RTCB Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86258-5-PBS

Clone No.250866G9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

HSPC117, 3'-phosphate/5'-hydroxy nucleic acid ligase, C22orf28, EC:6.5.1.8, FAAP

---

Product Information

86258-5-PBS targets RTCB in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13836

  Product name: Recombinant human C22orf28 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 159-505 aa of BC000151

  Sequence: GVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSARAKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDFDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKG

• Full Name: chromosome 22 open reading frame 28
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC000151
• Gene Symbol: RTCB
• Gene ID (NCBI): 51493
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y3I0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RTCB (also known as HSPC117, C22orf28, FAAP and D10Wsu52e) is an essential subunit of a tRNA ligase complex that is involved in RNA repair and stress-induced splicing. As a multifunctional protein, RTCB is also a cell adhesion protein and is important in embryo and placenta development. Recently RTCB has been identified as UPR RNA ligase catalyzing unconventional XBP1 mRNA splicing. This antibody specifically recognizes endogenous RTCB protein. (25087875)