RTKN2 Polyclonal antibody

• 

  WB analysis of HL-60 using 17458-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 17458-1-AP (RTKN2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 17458-1-AP

  WB result of RTKN2 antibody (17458-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RTKN2 transfected HEK-293 cells.

• 

  WB analysis of HEK-293 using 17458-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17458-1-AP (RTKN2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 17458-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 17458-1-AP (RTKN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lymph using 17458-1-AP

  mouse lymph tissue were subjected to SDS PAGE followed by western blot with 17458-1-AP (RTKN2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 17458-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 17458-1-AP (RTKN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 17458-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 17458-1-AP (RTKN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 17458-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 17458-1-AP (RTKN2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human placenta using 17458-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 17458-1-AP (RTKN2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skin using 17458-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 17458-1-AP (RTKN2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skin using 17458-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 17458-1-AP (RTKN2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human brain using 17458-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 17458-1-AP (RTKN2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 17458-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 17458-1-AP (RTKN2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HEK-293 using 17458-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using RTKN2 antibody (17458-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

RTKN2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17458-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PH domain-containing family K member 1, Pleckstrin homology domain-containing family K member 1, PLEKHK1, rhotekin 2, Rhotekin-2

---

Tested Applications

• Positive WB detected in: HL-60 cells, HEK-293 cells, mouse lymph tissue
• Positive IHC detected in: human placenta tissue, human brain tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 1 publications below

Product Information

17458-1-AP targets RTKN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11098

  Product name: Recombinant human RTKN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-163 aa of BC025765

  Sequence: MEGPSLRGPALRLAGLPTQQDCNIQEKIDLEIRMREGIWKLLSLSTQKDQVLHAVKNLMVCNARLMAYTSELQKLEEQIANQTGRCDVKFESKERTACKGKIAISDIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDICFENVTIL

• Full Name: rhotekin 2
• Calculated Molecular Weight: 163aa,19 kDa; 609aa,69 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC025765
• Gene Symbol: RTKN2
• Gene ID (NCBI): 219790
• RRID: AB_2034939
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZC4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; Cellular hormetic response to 27-hydroxycholesterol promotes neuroprotection through AICD induction of MAST4 abundance and kinase activity.; Authors - Brendan Gongol ; KD Validated
human	WB,IHC	J Viral Hepat; Depletion of circ_0088046 suppressed cell growth and motility of hepatocellular carcinoma via circ_0088046-miR-1299-RTKN2 ceRNA pathway; Authors - Li Zhang
human	WB	Sci Rep; RTKN2 knockdown alleviates the malignancy of breast cancer cells by regulating the Wnt/β-catenin pathway; Authors - Xiaomei Zhang