RTN2 Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 11168-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11168-1-AP (RTN2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 11168-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11168-1-AP (RTN2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 11168-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11168-1-AP (RTN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 11168-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11168-1-AP (RTN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 11168-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11168-1-AP (RTN2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skeletal muscle using 11168-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 11168-1-AP (RTN2 Antibody) at dilution of 1:50.

• 

  IHC staining of human skeletal muscle using 11168-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 11168-1-AP (RTN2 Antibody) at dilution of 1:50.

• Featured Product
• KD/KO Validated

RTN2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11168-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

NSP like protein 1, NSP like protein I, NSP2, NSPL1, NSPLI, reticulon 2, RTN2

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue
• Positive IHC detected in: human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below
• IHC: See 4 publications below
• IP: See 1 publications below

Product Information

11168-1-AP targets RTN2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1655

  Product name: Recombinant human RTN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 344-545 aa of BC014244

  Sequence: KVADLLYWKDTRTSGVVFTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQAVHRGDGANPFQAYLDVDLTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTLLILGVIGLFTIPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGALASAAAAVSGSKAKAE

• Full Name: reticulon 2
• Calculated Molecular Weight: 59 kDa, 51 kDa, 22 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC014244
• Gene Symbol: RTN2
• Gene ID (NCBI): 6253
• RRID: AB_10644321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75298
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER) (PMID: 18177508). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). They are involved in shaping the tubular endoplasmic reticulum network, membrane trafficking, inhibition of axonal growth, and apoptosis (PMID: 24218324). Four mammalian reticulons (RTN1-4) exist. Human RTN2 gene produces three isoforms termed RTN2-A, RTN2-B, and RTN2-C. Isoform RTN2-C has a calculated molecular weight of 22 kDa and is highly expressed in skeletal muscle.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cell Biol; Dynamic interaction of REEP5-MFN1/2 enables mitochondrial hitchhiking on tubular ER; Authors - Shue Chen
human	IHC	Mol Med Rep; RTN2, a new member of circadian clock genes identified by database mining and bioinformatics prediction, is highly expressed in ovarian cancer; Authors - Xiaojiao Zheng
human	WB,IHC	Cell Death Dis; Reticulon 2 promotes gastric cancer metastasis via activating endoplasmic reticulum Ca2+ efflux-mediated ERK signalling.; Authors - Shushu Song ; KD Validated
human	WB,IHC,IP	Cell Signal; O-GlcNAcylation enhances Reticulon 2 protein stability and its promotive effects on gastric cancer progression; Authors - Gaojia Wang
mouse	WB	Nature; Heteromeric clusters of ubiquitinated ER-shaping proteins drive ER-phagy; Authors - Hector Foronda
mouse	IHC	Neuroreport; Reticulon 4 reflects endoplasmic reticulum stress in arginine vasopressin neurons; Authors - Yohei Kawaguchi