RTN3 Polyclonal antibody

• 

  WB analysis using 12055-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12055-2-AP (RTN3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 12055-2-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12055-2-AP (RTN3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 12055-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12055-2-AP (RTN3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 12055-2-AP

  IP result of anti-RTN3 (IP:12055-2-AP, 4ug; Detection:12055-2-AP 1:400) with HeLa cells lysate 2000ug.

RTN3 Polyclonal Antibody for WB, IP, ELISA

Cat No. 12055-2-AP

Publications(32)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (4)

Applications

WB, IF, IP, ELISA

Synonyms

ASYIP, HAP, Homolog of ASY protein, Neuroendocrine-specific protein-like 2, Neuroendocrine-specific protein-like II

---

Tested Applications

• Positive WB detected in: HEK-293T cells, human brain tissue, HeLa cells, U-87 MG cells, U2OS cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 24 publications below
• IF: See 7 publications below
• IP: See 2 publications below

Product Information

12055-2-AP targets RTN3 in WB, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, monkey, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2685

  Product name: Recombinant human RTN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-236 aa of BC011394

  Sequence: MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE

• Full Name: reticulon 3
• Calculated Molecular Weight: 113 kDa
• Observed Molecular Weight: 24 kDa, 100-113 kDa
• GenBank Accession Number: BC011394
• Gene Symbol: RTN3
• Gene ID (NCBI): 10313
• RRID: AB_2301357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95197
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). Four mammalian reticulons (RTN1-4) exist. Reticulon3 (RTN3) is highly expressed in neurons. RTN3 has been shown to modulate secretory pathway protein trafficking. It is a negative modulator of BACE1 (β-secretase) proteolytic activity. RTN3 may induce caspase-8 cascade and apoptosis and may favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; ER proteins decipher the tubulin code to regulate organelle distribution; Authors - Pengli Zheng
mouse	WB,IF	Protein Cell; Senktide blocks aberrant RTN3 interactome to retard memory decline and tau pathology in social isolated Alzheimer's disease mice; Authors - He-Zhou Huang
human	WB	Nat Commun; AMFR-mediated Flavivirus NS2A ubiquitination subverts ER-phagy to augment viral pathogenicity; Authors - Linliang Zhang
		Acta Neuropathol; Integrative proteomics highlight presynaptic alterations and c-Jun misactivation as convergent pathomechanisms in ALS; Authors - Amr Aly
		EMBO J; Two FAM134B isoforms differentially regulate ER dynamics during myogenesis; Authors - Viviana Buonomo
rat	WB	J Pineal Res; Melatonin restores endoplasmic reticulum homeostasis to protect injured neurons in a rat model of chronic cervical cord compression; Authors - Min Yao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Chun (Verified Customer) (09-07-2020)

This is a very good antibody for immunoblotting.

• Applications: Western Blot
• Cell Tissue Type: HeLa