RTN3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RTN3 Polyclonal antibody (12055-2-AP)

RTN3 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 12055-2-AP Copied!

Publications (49)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF-P, IP, CoIP, ELISA

Synonyms

ASYIP, HAP, Homolog of ASY protein, Neuroendocrine-specific protein-like 2, Neuroendocrine-specific protein-like II

• 

  WB analysis using 12055-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12055-2-AP (RTN3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12055-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12055-2-AP (RTN3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 12055-2-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12055-2-AP (RTN3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 12055-2-AP

  IP result of anti-RTN3 (IP:12055-2-AP, 4ug; Detection:12055-2-AP 1:400) with HeLa cells lysate 2000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 12055-2-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 12055-2-AP (RTN3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 12055-2-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 12055-2-AP (RTN3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 12055-2-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using RTN3 antibody (12055-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RTN3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, human brain tissue, HeLa cells, U-87 MG cells, U2OS cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12055-2-AP targets RTN3 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, monkey, chicken, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2685

  Product name: Recombinant human RTN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-236 aa of BC011394

  Sequence: MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE

• Full Name: reticulon 3
• Calculated Molecular Weight: 113 kDa
• Observed Molecular Weight: 24 kDa, 100-113 kDa
• GenBank Accession Number: BC011394
• Gene Symbol: RTN3
• Gene ID (NCBI): 10313
• RRID: AB_2301357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95197
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). Four mammalian reticulons (RTN1-4) exist. Reticulon3 (RTN3) is highly expressed in neurons. RTN3 has been shown to modulate secretory pathway protein trafficking. It is a negative modulator of BACE1 (β-secretase) proteolytic activity. RTN3 may induce caspase-8 cascade and apoptosis and may favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress.

Publications

What published studies show

Anti-Reticulon 3 (RTN3) antibody, catalog number 12055-2-AP, has 49 total citations. Citations appear in journals including Nature, Nature Cell Biology, Nature Communications, Molecular Cell, Autophagy, EMBO Journal, Current Biology, Neuron, and Developmental Cell. Research fields span ER-phagy/reticulophagy, endoplasmic reticulum morphology, autophagy, neurodegeneration (Alzheimer's, Parkinson's, ALS), lipid metabolism, viral pathogenesis, and cancer biology.

Automatically generated from the 49 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; ER proteins decipher the tubulin code to regulate organelle distribution; Authors - Pengli Zheng
mouse	WB	Nature; Heteromeric clusters of ubiquitinated ER-shaping proteins drive ER-phagy; Authors - Hector Foronda
		Nature; Ageing promotes microglial accumulation of slow-degrading synaptic proteins; Authors - Ian H Guldner
rat	IF	Bioact Mater; Fibroblast exosomal TFAP2C induced by chitosan oligosaccharides promotes peripheral axon regeneration via the miR-132-5p/CAMKK1 axis; Authors - Yahong Zhao
rat,mouse,human	WB	Nat Cell Biol; Cholesterol sensing by the SCAP-FAM134B complex regulates ER-phagy and STING innate immunity.; Authors - Boran Li
mouse	IHC	Autophagy; Autophagy regulates PVALB (parvalbumin) interneuron excitability and memory.; Authors - Theodora Chalatsi

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

The product has one review from Chun Guo (September 2020), who rated it 4 out of 5 stars. The reviewer used the antibody for Western Blot on HeLa cells and described it as "a very good antibody for immunoblotting." Overall, the feedback is positive, with the user confirming reliable performance in WB applications.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Chun (Verified Customer) (09-07-2020)

This is a very good antibody for immunoblotting.

• Applications: Western Blot
• Cell Tissue Type: HeLa