RTN3 Monoclonal antibody, PBS Only (Detector)

RTN3 Monoclonal Antibody for WB, IP, Sandwich ELISA, Indirect ELISA
Cat No. 68215-1-PBS
Clone No.1E3H11

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IP, Sandwich ELISA, Indirect ELISA

ASYIP, HAP, NSP like protein 2, NSP like protein II, NSPL2, NSPLII, reticulon 3, RTN3, RTN3 A1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68215-1-PBS targets RTN3 as part of a matched antibody pair:

MP50025-1: 68215-2-PBS capture and 68215-1-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13766

Product name: Recombinant human RTN3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-236 aa of BC011394

Sequence: MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE

Predict reactive species
Full Name reticulon 3
Calculated Molecular Weight 113 kDa
Observed Molecular Weight25-28 kDa
GenBank Accession NumberBC011394
Gene Symbol RTN3
Gene ID (NCBI) 10313
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO95197
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). Four mammalian reticulons (RTN1-4) exist. Reticulon3 (RTN3) is highly expressed in neurons. RTN3 has been shown to modulate secretory pathway protein trafficking. It is a negative modulator of BACE1 (β-secretase) proteolytic activity. RTN3 may induce caspase-8 cascade and apoptosis and may favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress.

Loading...
||
New chat Able
正在加载,请稍候...