RUNX1T1 Monoclonal antibody

RUNX1T1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67086-1-Ig
Clone No.2G2F7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

Eight twenty one protein, Cyclin-D-related protein, CDR, CBFA2T1, AML1T1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HEK-293 cells, pig brain tissue, K-562 cells, rat brain tissue, mouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67086-1-Ig targets RUNX1T1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7893

Product name: Recombinant human RUNX1T1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-351 aa of BC005850

Sequence: MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREE

Predict reactive species
Full Name runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
Calculated Molecular Weight 68 kDa
Observed Molecular Weight 70-75 kDa
GenBank Accession NumberBC005850
Gene Symbol RUNX1T1
Gene ID (NCBI) 862
RRIDAB_2882394
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ06455
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RUNX1T1 is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. Various transcript of the fusion gene has been reported. RUNX1T1 exists some isoforms with MV 68, 67,64, 48 and 44 kDa. The calcualted molecular weight of RUNX1T1 is 67 kDa, but modified RUNX1T1is about 70-75 kDa.

Protocols

Product Specific Protocols
WB protocol for RUNX1T1 antibody 67086-1-IgDownload protocol
IHC protocol for RUNX1T1 antibody 67086-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...