RUNX2 Polyclonal antibody

• 

RUNX2 Polyclonal Antibody for ELISA

Cat No. 28107-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

IF, ELISA

Synonyms

AML3, CBF alpha 1, CBFA1, CCD, CCD1, Oncogene AML 3, OSF 2, OSF2, PEA2 alpha A, PEA2aA, PEBP2 alpha A, PEBP2A, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1, RUNX2

---

Published Applications

• IF: See 1 publications below

Product Information

28107-1-AP targets RUNX2 in IF, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27975

  Product name: Recombinant human RUNX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 240-370 aa of NM_001015051

  Sequence: MSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPF

• Full Name: runt-related transcription factor 2
• Calculated Molecular Weight: 57 aa
• GenBank Accession Number: NM_001015051
• Gene Symbol: RUNX2
• Gene ID (NCBI): 860
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13950
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Front Bioeng Biotechnol; Sustained delivery of osteogenic growth peptide through injectable photoinitiated composite hydrogel for osteogenesis; Authors - Beibei Liu