RUVBL2 Recombinant monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RUVBL2 Recombinant monoclonal antibody, PBS Only (Capture) (87557-1-PBS)

RUVBL2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 87557-1-PBS

Clone No.252919G3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

RUVB2, 48 kDa TATA box-binding protein-interacting protein, 48 kDa TBP-interacting protein, CGI-46, EC:3.6.4.12

• 

  WB analysis using 87557-1-RR (same clone as 87557-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87557-1-RR (RUVBL2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87557-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA sample test of MP03092-1

  The mean RUVBL2 concentration was determined to be 86.50 ng/mL in Daudi cell extract based on a 1.20 mg/mL extract load, 40.10 ng/mL in HepG2 cell based on a 1.20 mg/mL extract load, 35.90 ng/mL in HeLa cell extract based on a 1.20 mg/mL extract load and 18.05 ng/mL in A549 cell extract based on a 1.10 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP03092-1

  Sandwich ELISA standard curve of MP03092-1, Human RUVBL2 Recombinant Matched Antibody Pair - PBS only. 87557-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0253. 87557-2-PBS was HRP conjugated as the detection antibody. Range: 1.56-100 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of NIH/3T3 using 87557-1-RR (same clone as 87557-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using RUVBL2 antibody (87557-1-RR, Clone: 252919G3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 87557-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array sample test of MP03092-1

  The mean RUVBL2 concentration was determined to be 124.8 ng/mL in HeLa cell extract based on a 1.2 mg/mL extract load, 136.5 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load, 106.5 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP03092-1

  Cytometric bead array standard curve of MP03092-1, RUVBL2 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87557-1-PBS. Detection antibody: 87557-2-PBS. Standard: Ag0253. Range: 0.625-80 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87557-1-PBS targets RUVBL2 as part of a matched antibody pair:

MP03092-1: 87557-1-PBS capture and 87557-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0253

  Product name: Recombinant human RUVBL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-463 aa of BC000428

  Sequence: SQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

• Full Name: RuvB-like 2 (E. coli)
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC000428
• Gene Symbol: RUVBL2
• Gene ID (NCBI): 10856
• RRID: AB_3745620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y230
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RUVBL2 belongs to the conserved ATPases associated with various cellular activities (AAA+) protein subfamily, which is characterized by the presence of conserved Walker A and B motifs that are involved in ATP binding and hydrolysis. The AAA+ (ATPases associated with diverse cellular activities) ATPases, RUVBL1 and RUVBL2, were originally isolated as components of transcriptional complexes and shown to function in a number of different cellular processes, including transcriptional regulation, chromatin remodelling and DNA damage responses. (PMID: 31572066, PMID: 31138842)