RWDD4A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RWDD4A Polyclonal antibody (32101-1-AP)

• 

  WB analysis using 32101-1-AP

  5637 cells were subjected to SDS PAGE followed by western blot with 32101-1-AP (RWDD4A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

RWDD4A Polyclonal Antibody for WB, ELISA

Cat No. 32101-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

RWDD4, RWD domain-containing protein 4, Protein FAM28A, FAM28A

---

Tested Applications

• Positive WB detected in: 5637 cells, SH-SY5Y cells, U-251 cells, U-87MG cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32101-1-AP targets RWDD4A in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36777

  Product name: Recombinant human RWDD4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-188 aa of BC107432

  Sequence: MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAMTYTLFEYAKDNKEQFMENHNPINSATSISNIISIETPNTAPSSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDDE

• Full Name: RWD domain containing 4A
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC107432
• Gene Symbol: RWDD4A
• Gene ID (NCBI): 201965
• RRID: AB_3670191
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6NW29
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RWDD4, which is a poorly characterized gene that encodes the protein RWD Domain Containing 4, with an RWD domain being involved in protein-protein interactions (PMID: 27916600). RWDD4 was revealed to be a miR506 target in BCa cells, and the downregulation of RWDD4 was found to suppress BCa cell proliferation, migration and invasion (PMID: 30655740).