RanBP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RanBP1 Polyclonal antibody, PBS Only (27804-1-PBS)

• 

  WB analysis using 27804-1-AP (same clone as 27804-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27804-1-AP (RanBP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27804-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27804-1-AP (same clone as 27804-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27804-1-AP (RanBP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27804-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 27804-1-AP (same clone as 27804-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 27804-1-AP (RanBP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27804-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 27804-1-AP (same clone as 27804-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 27804-1-AP (RanBP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27804-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 27804-1-AP (same clone as 27804-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27804-1-AP (RanBP1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27804-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 27804-1-AP (same clone as 27804-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RanBP1 antibody (27804-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 27804-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 27804-1-AP (same clone as 27804-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using RanBP1 antibody (27804-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27804-1-PBS in a different storage buffer formulation.

RanBP1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 27804-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

27804-1-PBS targets RanBP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25714

  Product name: Recombinant human RANBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-60 aa of

  Sequence: MLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQ

• Full Name: RAN binding protein 1
• Observed Molecular Weight: 28 kDa
• Gene Symbol: RANBP1
• Gene ID (NCBI): 5902
• RRID: AB_2880977
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43487
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RanBP1 (Ran-binding protein 1) belongs to the RANBP1 family. RanBP1 plays a role in RAN-dependent nucleocytoplasmic transport. It alleviates the TNPO1-dependent inhibition of RAN GTPase activity and mediates the dissociation of RAN from proteins involved in transport into the nucleus. And RanBP1 induces a conformation change in the complex formed by XPO1 and RAN that triggers the release of the nuclear export signal of cargo proteins (PMID:20485264). RanBP1 promotes dissociation of RAN from a complex with KPNA2 and CSE1L. It required for normal mitotic spindle assembly and normal progress through mitosis via its effect on RAN (PMID:17671426). Also, RanBP1 inhibits RCC1-dependent exchange of RAN-bound GDP by GTP (PMID:7882974, PMID:7616957).