Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, Ramos cells, Y79 cells |
| Positive IHC detected in | rat liver tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27606-1-AP targets RanBP2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26370 Product name: Recombinant human RANBP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2801-2900 aa of NM_006267 Sequence: MKSISSPSVSSETMDKPVDLSTRKEIDTDSTSQGESKIVSFGFGSSTGLSFADLASSNSGDFAFGSKDKNFQWANTGAAVFGTQSVGTQSAGKVGEDEDGS Predict reactive species |
| Full Name | RAN binding protein 2 |
| Calculated Molecular Weight | 358 kDa |
| Observed Molecular Weight | 358 kDa |
| GenBank Accession Number | NM_006267 |
| Gene Symbol | RANBP2 |
| Gene ID (NCBI) | 5903 |
| RRID | AB_2880923 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49792 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RanBP2 (Ran-binding protein 2) is also named as p270 and NUP358, and belongs to the RanBP2 E3 ligase family. RanBP2 is E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I (PMID:11792325, PMID:22194619). RanBP2 involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates (PMID:7775481). It is component of the nuclear export pathway (PMID:10078529). RanBP2 recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle (PMID:20386726).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RanBP2 antibody 27606-1-AP | Download protocol |
| WB protocol for RanBP2 antibody 27606-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RanBP2 Polyclonal antibody (Cat# 27606-1-AP) has 6 citations published in Nature Physics, Cell Death Discovery, Oncogene, Journal of Molecular Biology (×2), and Frontiers in Oncology. Research fields span nuclear pore protein transport, lncRNA nuclear export, nasopharyngeal carcinoma, cervical cancer progression via m6A modification, RANBP2 isoform diversity, and viral disruption of stress granule formation.
| Species | Application | Title |
|---|---|---|
Nat Phys Structural anisotropy results in mechano-directional transport of proteins across nuclear pores
| ||
Cell Death Discov Exon junction complex and nuclear pore complex components preferentially govern the nuclear export of spliced lncRNAs. | ||
Oncogene PinX1 inhibits migrasomes-mediated mitochondrial transfer to confer cisplatin sensitivity in nasopharyngeal carcinoma.
| ||
J Mol Biol Unraveling the Diversity of RANBP2: Protein Isoforms and Implications for Cellular Function and Human Disease. | ||
Front Oncol YTHDF1 Aggravates the Progression of Cervical Cancer Through m6A-Mediated Up-Regulation of RANBP2.
|
