Raptor Monoclonal antibody, PBS Only

Raptor Monoclonal Antibody for WB, IP, Indirect ELISA
Cat No. 68286-1-PBS
Clone No.1B8A12

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IP, Indirect ELISA

KIAA1303, raptor, RPTOR

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68286-1-PBS targets Raptor in WB, IP, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30131

Product name: Recombinant human KIAA1303 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1195-1335 aa of BC136654

Sequence: RRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR

Predict reactive species
Full Name raptor
Calculated Molecular Weight 1335 aa, 149 kDa
Observed Molecular Weight 130-150 kDa
GenBank Accession NumberBC136654
Gene Symbol Raptor
Gene ID (NCBI) 57521
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N122
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RPTOR, also named as KIAA1303 and RAPTOR Belongs to the WD repeat RAPTOR family. It is involved in the control of the mammalian target of rapamycin complex 1 (mTORC1) activity which regulates cell growth and survival, and autophagy in response to nutrient and hormonal signals; functions as a scaffold for recruiting mTORC1 substrates. mTORC1 is activated in response to growth factors or amino-acids. Amino-acid-signaling to mTORC1 is mediated by Rag GTPases, which cause amino-acid-induced relocalization of mTOR within the endomembrane system. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-389', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation.

Loading...
||
New chat Able
正在加载,请稍候...