Rhodopsin Polyclonal antibody

• 

  IHC staining of mouse eye using 30438-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 30438-1-AP (Rhodopsin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat eye using 30438-1-AP

  Immunohistochemical analysis of paraffin-embedded rat eye tissue slide using 30438-1-AP (Rhodopsin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Rhodopsin Polyclonal Antibody for IHC, ELISA

Cat No. 30438-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CSNBAD1, OPN2, Opsin 2, RHO, rhodopsin, RP4

---

Tested Applications

• Positive IHC detected in: mouse eye tissue, rat eye tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

30438-1-AP targets Rhodopsin in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30879

  Product name: Recombinant human Rhodopsin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of NM_000539

  Sequence: MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT

• Full Name: rhodopsin
• Calculated Molecular Weight: 39 kDa
• GenBank Accession Number: NM_000539
• Gene Symbol: Rhodopsin
• Gene ID (NCBI): 6010
• RRID: AB_3086314
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08100
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Exp Eye Res; Deferiprone protects photoreceptors by inhibiting ferroptosis after experimental retinal detachment; Authors - Ziyang Ye