Rhodopsin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Rhodopsin Polyclonal antibody (30438-1-AP)

Rhodopsin Polyclonal Antibody for IHC, ELISA

Cat No. 30438-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

CSNBAD1, OPN2, Opsin 2, RHO, rhodopsin, RP4

• 

  IHC staining of mouse eye using 30438-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 30438-1-AP (Rhodopsin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat eye using 30438-1-AP

  Immunohistochemical analysis of paraffin-embedded rat eye tissue slide using 30438-1-AP (Rhodopsin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Rhodopsin in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: mouse eye tissue, rat eye tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30438-1-AP targets Rhodopsin in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30879

  Product name: Recombinant human Rhodopsin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of NM_000539

  Sequence: MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT

• Full Name: rhodopsin
• Calculated Molecular Weight: 39 kDa
• GenBank Accession Number: NM_000539
• Gene Symbol: Rhodopsin
• Gene ID (NCBI): 6010
• RRID: AB_3086314
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08100
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Rhodopsin Polyclonal antibody (Cat# 30438-1-AP) has 3 total citations. These appear in J Nanobiotechnology, Cell Biosci, and Exp Eye Res. The associated research fields include diabetic retinopathy treatment via engineered extracellular vesicles, retinal neurodegeneration in neuronal intranuclear inclusion disease, and photoreceptor protection against ferroptosis after experimental retinal detachment.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		J Nanobiotechnology; Engineered MEVs for photoreceptor-targeted delivery of USP25 to alleviate diabetic retinopathy; Authors - Yaoxiang Sun
mouse	IF	Cell Biosci; NOTCH2NLC GGC repeat expansions cause retinal neurodegeneration in neuronal intranuclear inclusion disease mouse model.; Authors - Haibo Li
mouse	WB	Exp Eye Res; Deferiprone protects photoreceptors by inhibiting ferroptosis after experimental retinal detachment; Authors - Ziyang Ye