• Featured Product
  • KD/KO Validated

Ribosomal protein L4 Polyclonal antibody

Ribosomal protein L4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 30182-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

RPL4, 60S ribosomal protein L1, 60S ribosomal protein L4, RPL 4, RPL1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30182-1-AP targets Ribosomal protein L4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32272

Product name: Recombinant human RPL4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 60-340 aa of BC009888

Sequence: HQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRIQRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTI

Predict reactive species
Full Name ribosomal protein L4
Calculated Molecular Weight 48 kDa
Observed Molecular Weight48 kDa
GenBank Accession NumberBC009888
Gene Symbol Ribosomal protein L4
Gene ID (NCBI) 6124
RRIDAB_3086255
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP36578
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

60S ribosomal protein L4 is encoded by RPL4 (or RPL1) gene. RPL4 is a component of 60S subunit of ribosome, and belongs to the L4E family. By interacting with c-Myb, RPL4 plays a important role in c-myc expression in response to growth factor and nutritional signals. Recently RPL4 was reported to be able to increase effeiciency of viral recoding sequence.

Protocols

Product Specific Protocols
IF protocol for Ribosomal protein L4 antibody 30182-1-APDownload protocol
IHC protocol for Ribosomal protein L4 antibody 30182-1-APDownload protocol
WB protocol for Ribosomal protein L4 antibody 30182-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...