S100A4 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

S100A4 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84221-2-PBS
Clone No.241448B1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Calvasculin, CAPL, Fibroblast Specific Protein, Fibroblast-specific protein 1, Fibroblast-specific protein-1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84221-2-PBS targets S100A4 as part of a matched antibody pair:

MP01155-1: 84221-3-PBS capture and 84221-2-PBS detection (validated in Cytometric bead array)

MP01155-2: 84221-2-PBS capture and 84221-1-PBS detection (validated in Cytometric bead array)

MP01155-3: 84221-2-PBS capture and 84221-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9019

Product name: Recombinant human S100A4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-101 aa of BC016300

Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Predict reactive species
Full Name S100 calcium binding protein A4
Calculated Molecular Weight 101 aa, 12 kDa
GenBank Accession NumberBC016300
Gene Symbol S100A4
Gene ID (NCBI) 6275
ENSEMBL Gene IDENSG00000196154
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP26447
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...