S100A5 Polyclonal antibody

S100A5 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 17924-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

S100D, S100 calcium-binding protein A5, Protein S-100D, Protein S100-A5, Protein S100 A5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, human kidney tissue, human liver tissue, SH-SY5Y cells
Positive IHC detected inhuman meningioma tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17924-1-AP targets S100A5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12342

Product name: Recombinant human S100A5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-110 aa of BC093955

Sequence: MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK

Predict reactive species
Full Name S100 calcium binding protein A5
Calculated Molecular Weight 110 aa, 13 kDa
Observed Molecular Weight 11 kDa
GenBank Accession NumberBC093955
Gene Symbol S100A5
Gene ID (NCBI) 6276
RRIDAB_2183794
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP33763
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for S100A5 antibody 17924-1-APDownload protocol
IHC protocol for S100A5 antibody 17924-1-APDownload protocol
WB protocol for S100A5 antibody 17924-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC,IF

Adv Sci (Weinh)

S100A5 Attenuates Efficiency of Anti-PD-L1/PD-1 Immunotherapy by Inhibiting CD8+ T Cell-Mediated Anti-Cancer Immunity in Bladder Carcinoma

Authors - Huihuang Li
mouseIHC

Mol Cell Proteomics

The Membrane Proteome of Sensory Cilia to the Depth of Olfactory Receptors.

Authors - Katja Kuhlmann
Loading...
||
New chat Able
正在加载,请稍候...