S100A6 Monoclonal antibody, PBS Only

S100A6 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA
Cat No. 66098-1-PBS
Clone No.3D11C8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

3D11C8, CABP, CACY, Calcyclin, Growth factor-inducible protein 2A9

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66098-1-PBS targets S100A6 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17606

Product name: Recombinant human S100A6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-90 aa of BC001431

Sequence: MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Predict reactive species
Full Name S100 calcium binding protein A6
Calculated Molecular Weight 10 kDa
Observed Molecular Weight 10 kDa
GenBank Accession NumberBC001431
Gene Symbol S100A6
Gene ID (NCBI) 6277
RRIDAB_2881497
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP06703
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

S100A6 is also named as calcyclin, prolactin receptor-associated protein (PRA), growth factor-inducible protein 2A9 ir MLN4. It belongs to S100 family of low molecular weight, acidic, calcium-binding proteins which contain two EF-hand calcium binding sites. S100A6 may function as a calcium sensor to activate several processes in the calcium signal transduction pathway of cell growth, proliferation, secretion and exocytosis. Although S100A6 is a cytoplasmic protein, it can be located in the nuclear and cytoplasmic membranes in the presence of Ca2+ (PMID: 37670392).

Loading...
||
New chat Able
正在加载,请稍候...