Filter: AllWBIHCIF/ICC

WB analysis of HeLa using 66098-1-Ig (same clone as 66098-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 66098-1-Ig (S100A6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66098-1-PBS in a different storage buffer formulation.
WB analysis of A549 using 66098-1-Ig (same clone as 66098-1-PBS)
A549 cells were subjected to SDS PAGE followed by western blot with 66098-1-Ig (S100A6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66098-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 66098-1-Ig (same clone as 66098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66098-1-Ig (S100A6 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66098-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 66098-1-Ig (same clone as 66098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66098-1-Ig (S100A6 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66098-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 66098-1-Ig (same clone as 66098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66098-1-Ig (S100A6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66098-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 66098-1-Ig (same clone as 66098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66098-1-Ig (S100A6 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66098-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 66098-1-Ig (same clone as 66098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66098-1-Ig (S100A6 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66098-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 66098-1-Ig (same clone as 66098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 66098-1-Ig (S100A6 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 66098-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 66098-1-Ig (same clone as 66098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer slide using 66098-1-Ig (S100A6 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 66098-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 66098-1-Ig (same clone as 66098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 66098-1-Ig (S100A6 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 66098-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 66098-1-Ig (same clone as 66098-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer slide using 66098-1-Ig (S100A6 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 66098-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 66098-1-Ig (same clone as 66098-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using S100A6 antibody (66098-1-Ig, Clone: 3D11C8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66098-1-PBS in a different storage buffer formulation.

S100A6 Monoclonal antibody, PBS Only

S100A6 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66098-1-PBS

Clone No.3D11C8

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

3D11C8, CABP, CACY, Calcyclin, Growth factor-inducible protein 2A9

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

66098-1-PBS targets S100A6 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag17606 Product name: Recombinant human S100A6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-90 aa of BC001431 Sequence: MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG Predict reactive species
Full Name	S100 calcium binding protein A6
Calculated Molecular Weight	10 kDa
Observed Molecular Weight	10 kDa
GenBank Accession Number	BC001431
Gene Symbol	S100A6
Gene ID (NCBI)	6277
RRID	AB_2881497
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P06703
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

S100A6 is also named as calcyclin, prolactin receptor-associated protein (PRA), growth factor-inducible protein 2A9 ir MLN4. It belongs to S100 family of low molecular weight, acidic, calcium-binding proteins which contain two EF-hand calcium binding sites. S100A6 may function as a calcium sensor to activate several processes in the calcium signal transduction pathway of cell growth, proliferation, secretion and exocytosis. Although S100A6 is a cytoplasmic protein, it can be located in the nuclear and cytoplasmic membranes in the presence of Ca2+ (PMID: 37670392).