Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Mouse S100A8 Rabbit Recombinant Antibody, PBS Only (98467-2-PBS)

Anti-Mouse S100A8 Rabbit Recombinant Antibody, PBS Only

Name: Anti-Mouse S100A8 Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98467-2-PBS-1MG

S100A8 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98467-2-PBS

Clone No. 250113D8

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

Caga, Calgranulin-A, Chemotactic cytokine CP-10, Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC (Intra)

FC experiment of Transfected HEK-293T using 98467-2-RR (same clone as 98467-2-PBS)
1x10^6 HEK-293T cells (left) or S100A8-transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Mouse S100A8 Rabbit RecAb (98467-2-RR, Clone: 250113D8) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98467-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HEK-293T cells (left) or S100A8-transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Mouse S100A8 Rabbit RecAb (98467-2-RR, Clone: 250113D8) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98467-2-PBS in a different storage buffer formulation.
FC experiment of Transfected HEK-293T using 98467-2-RR (same clone as 98467-2-PBS)
1x10^6 HEK-293T cells (left) or S100A8-transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Mouse S100A8 Rabbit RecAb (98467-2-RR, Clone: 250113D8) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98467-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HEK-293T cells (left) or S100A8-transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Mouse S100A8 Rabbit RecAb (98467-2-RR, Clone: 250113D8) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98467-2-PBS in a different storage buffer formulation.

Able AI

What's the best dilution for S100A8 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98467-2-PBS targets S100A8 in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg2959 Product name: Recombinant Mouse S100A8 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 2-89 aa of NM_013650.2 Sequence: PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE Predict reactive species
Full Name	S100 calcium binding protein A8 (calgranulin A)
Calculated Molecular Weight	10 kDa
GenBank Accession Number	NM_013650.2
Gene Symbol	S100a8
Gene ID (NCBI)	20201
RRID	AB_3746096
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P27005
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine.