S100A9 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of MCF-7 using 83578-2-RR (same clone as 83578-2-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 83578-2-RR (S100A9 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83578-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 83578-2-PBS

  Various lysates were subjected to SDS PAGE followed by western blot with 83578-2-PBS (S100A9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 83578-2-RR (same clone as 83578-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83578-2-RR (S100A9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83578-2-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 83578-2-RR (same clone as 83578-2-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using S100A9 antibody (83578-2-RR, Clone: 240539G9 ) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 83578-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 83578-2-RR (same clone as 83578-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using S100A9 antibody (83578-2-RR, Clone: 240539G9 ) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 83578-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83578-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 83578-2-PBS against Human S100A9 was performed. The affinity constant is 0.389 nM.

• 

  Affinity and Kinetic Characterization of 83578-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83578-2-RR against Human S100A9 were performed. The affinity constant is below 1 pM.

S100A9 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 83578-2-PBS

Clone No.240539G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

240539G9, CAGB, Calgranulin B, Calgranulin-B, Calprotectin L1H subunit

---

Tested Applications

• Positive WB detected in: THP-1 cells, MCF-7 cells, HL-60 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

83578-2-PBS targets S100A9 in WB, IF/ICC, Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25764

  Product name: Recombinant human S100A9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-114 aa of BC047681

  Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

• Full Name: S100 calcium binding protein A9
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC047681
• Gene Symbol: S100A9
• Gene ID (NCBI): 6280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P06702
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer with an S100A8 partner (S100A8/A9), or as a heterotetramer with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages.