S100A9 Recombinant monoclonal antibody, PBS Only

S100A9 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 83578-2-PBS
Clone No.240539G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

240539G9, CAGB, Calgranulin B, Calgranulin-B, Calprotectin L1H subunit

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTHP-1 cells, MCF-7 cells, HL-60 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

83578-2-PBS targets S100A9 in WB, IF/ICC, Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25764

Product name: Recombinant human S100A9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-114 aa of BC047681

Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Predict reactive species
Full Name S100 calcium binding protein A9
Calculated Molecular Weight 13 kDa
Observed Molecular Weight 14 kDa
GenBank Accession NumberBC047681
Gene Symbol S100A9
Gene ID (NCBI) 6280
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP06702
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer with an S100A8 partner (S100A8/A9), or as a heterotetramer with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages.

Protocols

Product Specific Protocols
WB protocol for S100A9 antibody 83578-2-PBSDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...