S100A9 Recombinant monoclonal antibody, PBS Only (Detector)

S100A9 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA
Cat No. 83578-6-PBS
Clone No.240539F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA

240539F4, CAGB, Calgranulin B, Calgranulin-B, Calprotectin L1H subunit

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

83578-6-PBS targets S100A9 as part of a matched antibody pair:

MP00569-4: 83578-8-PBS capture and 83578-6-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25764

Product name: Recombinant human S100A9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-114 aa of BC047681

Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Predict reactive species
Full Name S100 calcium binding protein A9
Calculated Molecular Weight 13 kDa
GenBank Accession NumberBC047681
Gene Symbol S100A9
Gene ID (NCBI) 6280
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP06702
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer (24 kDa) with an S100A8 partner (S100A8/A9), or as a heterotetramer (28 kDa) with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages.

Loading...
||
New chat Able
正在加载,请稍候...