S100B Recombinant monoclonal antibody, PBS Only (Detector)

S100B Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 82271-11-PBS
Clone No.230169B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

S100 beta, Protein S100 B, Protein S100-B, S100 calcium-binding protein B, S-100 protein beta chain

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82271-11-PBS targets S100B as part of a matched antibody pair:

MP01165-2: 82271-10-PBS capture and 82271-11-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7440

Product name: Recombinant human S100B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-92 aa of BC001766

Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Predict reactive species
Full Name S100 calcium binding protein B
Calculated Molecular Weight 11 kDa
GenBank Accession NumberBC001766
Gene Symbol S100 Beta
Gene ID (NCBI) 6285
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04271
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...