S100B Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP01165-2

  Sandwich ELISA standard curve of MP01165-2, Human S100B Recombinant Matched Antibody Pair - PBS only. 82271-10-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag7440. 82271-11-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL

• 

  Sample test of MP01165-2

  Cerebrospinal fluid of one individual human donor was measured. The S100B concentration of detected samples was determined to be 5,863.1 pg/mL.

• 

  Sample test of MP01165-2

  The mean S100B concentration was determined to be 4,145.60 ng/mL in mouse brain tissue extract based on a 2.20 mg/mL extract load and 28,511.12 ng/mL in rat brain tissue extract based on a 1.60 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP01165-2

  Cytometric bead array standard curve of MP01165-2, S100B Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 82271-10-PBS. Detection antibody: 82271-11-PBS. Standard: Ag7440. Range: 0.625-20 ng/mL.

• 

  Affinity and Kinetic Characterization of 82271-11-PBS

  Biolayer interferometry (BLl) kinetic assay of 82271-11-PBS against Human S100B was performed. The affinity constant is 5.88 nM.

S100B Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 82271-11-PBS

Clone No.230169B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

S100 beta, Protein S100 B, Protein S100-B, S100 calcium-binding protein B, S-100 protein beta chain

---

Product Information

82271-11-PBS targets S100B as part of a matched antibody pair:

MP01165-2: 82271-10-PBS capture and 82271-11-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7440

  Product name: Recombinant human S100B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-92 aa of BC001766

  Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

• Full Name: S100 calcium binding protein B
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: BC001766
• Gene Symbol: S100 Beta
• Gene ID (NCBI): 6285
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04271
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.