Product Information
85059-1-PBS targets S1PR1 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag28083 Product name: Recombinant human S1PR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 311-382 aa of BC018650 Sequence: YTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS Predict reactive species |
| Full Name | sphingosine-1-phosphate receptor 1 |
| Calculated Molecular Weight | 43 kDa |
| GenBank Accession Number | BC018650 |
| Gene Symbol | S1PR1 |
| Gene ID (NCBI) | 1901 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P21453 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
