SAA Polyclonal antibody

• 

  WB analysis of serum from mouse injected with bacteria using 13192-1-AP

  serum from mouse injected with bacteria were subjected to SDS PAGE followed by western blot with 13192-1-AP (SAA2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 13192-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 13192-1-AP (SAA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 13192-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 13192-1-AP (SAA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 13192-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using SAA antibody (13192-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

SAA Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13192-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SAA2, Amyloid A2 protein, serum amyloid A2, Serum amyloid A-2 protein

---

Tested Applications

• Positive WB detected in: serum from mouse injected with bacteria
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 2 publications below
• IF: See 3 publications below

Product Information

13192-1-AP targets SAA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3869

  Product name: Recombinant human SAA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC020795

  Sequence: MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY

• Full Name: serum amyloid A2
• Calculated Molecular Weight: 122 aa, 14 kDa
• Observed Molecular Weight: 12-13 kDa
• GenBank Accession Number: BC020795
• Gene Symbol: SAA2
• Gene ID (NCBI): 6289
• RRID: AB_2877923
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0DJI9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human SAA proteins are a group of apolipoproteins mainly found in the high density lipoprotein (HDL) portion of plasma. The serum amyloid A (SAA) protein is an acute phase apolipoprotein reactant produced mainly by hepatocytes and under the regulation of inflammatory cytokines(PMID: 12011456). Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA2 protein(PMID: 1463770). This antibody can recognize SAA1 and SAA2.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	J Crohns Colitis; Lysophosphatidylcholine-Induced Aberrant Adipogenesis in Mesenchymal Stem Cells and Impaired Antibacterial Function in Adipocytes of Creeping Fat; Authors - Fangting Wu
mouse	IF	J Allergy Clin Immunol; Small Proline-Rich Protein 2A Drives Epithelial Remodeling in Eosinophilic Chronic Rhinosinusitis with Nasal Polyps via SAA2 Upregulation; Authors - Shaobing Xie
human	WB,IF	Inflammation; Interleukin-1β Induces Intracellular Serum Amyloid A1 Expression in Human Coronary Artery Endothelial Cells and Promotes its Intercellular Exchange.; Authors - Tadeja Kuret
mouse	WB	Int Immunopharmacol; Artesunate attenuates serum amyloid A-induced M1 macrophage differentiation through the promotion of PHGDH; Authors - Xinhui Lu
human	IHC	Oncol Lett; Gene expression profiling and the isocitrate dehydrogenase mutational landscape of temozolomide‑resistant glioblastoma; Authors - Wu-Fu Chen
mouse	IF	bioRxiv; Single cell RNA sequencing reveals a shift in cell function and maturation of endogenous and infiltrating cell types in response to acute intervertebral disc injury; Authors - Sade W Clayton