SAA Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SAA Polyclonal antibody (13192-1-AP)

SAA Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13192-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SAA2, Amyloid A2 protein, serum amyloid A2, Serum amyloid A-2 protein

• 

  WB analysis of serum from mouse injected with bacteria using 13192-1-AP

  serum from mouse injected with bacteria were subjected to SDS PAGE followed by western blot with 13192-1-AP (SAA2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 13192-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 13192-1-AP (SAA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 13192-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 13192-1-AP (SAA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 13192-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using SAA antibody (13192-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SAA in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: serum from mouse injected with bacteria
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13192-1-AP targets SAA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3869

  Product name: Recombinant human SAA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC020795

  Sequence: MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY

• Full Name: serum amyloid A2
• Calculated Molecular Weight: 122 aa, 14 kDa
• Observed Molecular Weight: 12-13 kDa
• GenBank Accession Number: BC020795
• Gene Symbol: SAA2
• Gene ID (NCBI): 6289
• RRID: AB_2877923
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0DJI9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human SAA proteins are a group of apolipoproteins mainly found in the high density lipoprotein (HDL) portion of plasma. The serum amyloid A (SAA) protein is an acute phase apolipoprotein reactant produced mainly by hepatocytes and under the regulation of inflammatory cytokines(PMID: 12011456). Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA2 protein(PMID: 1463770). This antibody can recognize SAA1 and SAA2.

Publications

What published studies show

The antibody targeting Serum Amyloid A (SAA), catalog number 13192-1-AP, has 10 total citations published in journals including Advanced Science, Journal of Allergy and Clinical Immunology, Journal of Crohn's and Colitis, Journal of Translational Medicine, Journal of Investigative Dermatology, International Immunopharmacology, Inflammation, Experimental Cell Research, Oncology Letters, and bioRxiv. Research fields span liver transplant injury, eosinophilic chronic rhinosinusitis, aberrant adipogenesis, hepatocellular carcinoma, sweat gland aging, macrophage polarization, coronary endothelial inflammation, intervertebral disc injury, and glioblastoma.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human, mouse	WB,IF	Adv Sci (Weinh); SAA/FPR2 Signaling Between Pericentral Hepatocytes and Macrophages Exacerbates Zonated Liver Transplant Injury.; Authors - Feng Zhang
mouse	IF	J Allergy Clin Immunol; Small Proline-Rich Protein 2A Drives Epithelial Remodeling in Eosinophilic Chronic Rhinosinusitis with Nasal Polyps via SAA2 Upregulation; Authors - Shaobing Xie
mouse	IHC	J Crohns Colitis; Lysophosphatidylcholine-Induced Aberrant Adipogenesis in Mesenchymal Stem Cells and Impaired Antibacterial Function in Adipocytes of Creeping Fat; Authors - Fangting Wu
human	WB,IHC	J Transl Med; Single-cell RNA sequencing reveals a B cell-related immunosuppressive landscape and a potential suppressor in hepatocellular carcinoma.; Authors - Wenhao Hou
		J Invest Dermatol; Dendritic cells remodel eccrine sweat gland niche metabolism through oxidative phosphorylation during aging.; Authors - Yuanli Ye
mouse	WB	Int Immunopharmacol; Artesunate attenuates serum amyloid A-induced M1 macrophage differentiation through the promotion of PHGDH; Authors - Xinhui Lu