SAA4 Polyclonal antibody

• 

  WB analysis using 20398-1-AP

  Human plasma lysates were subjected to SDS PAGE followed by western blot with 20398-1-AP (SAA4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 20398-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver slide using 20398-1-AP (SAA4 Antibody) at dilution of 1:50.

• 

  IHC staining of human liver using 20398-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver slide using 20398-1-AP (SAA4 Antibody) at dilution of 1:50.

SAA4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20398-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

C SAA, CSAA, SAA4, Serum amyloid A 4 protein, serum amyloid A4, constitutive

---

Tested Applications

• Positive WB detected in: human plasma
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20398-1-AP targets SAA4 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14081

  Product name: Recombinant human SAA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-130 aa of BC007026

  Sequence: MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY

• Full Name: serum amyloid A4, constitutive
• Calculated Molecular Weight: 130 aa, 15 kDa
• Observed Molecular Weight: 12-15 kDa
• GenBank Accession Number: BC007026
• Gene Symbol: SAA4
• Gene ID (NCBI): 6291
• RRID: AB_2878682
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35542
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.