SAAL1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SAAL1 Polyclonal antibody (25467-1-AP)

• 

  WB analysis using 25467-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25467-1-AP (SAAL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 25467-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SAAL1 antibody (25467-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

SAAL1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25467-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

Protein SAAL1, serum amyloid A like 1, SPACIA1, Synoviocyte proliferation-associated in collagen-induced arthritis protein 1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, L02 cells, MCF-7 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

25467-1-AP targets SAAL1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22186

  Product name: Recombinant human SAAL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 181-475 aa of BC012010

  Sequence: HPAIYDSICFIMSSSTNVDLLVKVGEVVDKLFDLDEKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWLDVYMHILQLLTTVDDGIQAIVHCPDTGKDIWNLLFDLVCHEFCQSDDPPIILQEQKTVLASVFSVLSAIYASQTEQEYLKIEKVDLPLIDSLIRVLQNMEQCQKKPENSAESNTEETKRTDLTQDDFHLKILKDILCEFLSNIFQALTKETVAQGVKEGQLSKQKCSSAFQNLLPFYSPVVEDFIKILREVDKALADDLEKNFPSLKVQT

• Full Name: serum amyloid A-like 1
• Calculated Molecular Weight: 475 aa, 54 kDa
• Observed Molecular Weight: 54-55 kDa
• GenBank Accession Number: BC012010
• Gene Symbol: SAAL1
• Gene ID (NCBI): 113174
• RRID: AB_2880094
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96ER3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Front Pharmacol; Bicyclol attenuates high fat diet-induced non-alcoholic fatty liver disease/non-alcoholic steatohepatitis through modulating multiple pathways in mice; Authors - Jingyi Wu
human	WB	BMC Cancer; The effects of the prognostic biomarker SAAL1 on cancer growth and its association with the immune microenvironment in lung adenocarcinoma; Authors - Song Tong