Tested Applications
| Positive WB detected in | HepG2 cells, HEK-293 cells, HeLa cells, MCF-7 cells, A431 cells, HCT 116 cells, COLO 320 cells |
| Positive IHC detected in | mouse testis tissue, human testis tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21857-1-AP targets SAFB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16451 Product name: Recombinant human SAFB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 58-213 aa of BC126219 Sequence: MERLKKAIEDEGGNPDEIEITSEGNKKTSKRSSKGRKPEEEGVEDNGLEENSGDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFTILQEIEEPSLEPE Predict reactive species |
| Full Name | scaffold attachment factor B |
| Calculated Molecular Weight | 917 aa, 103 kDa |
| Observed Molecular Weight | 150 kDa |
| GenBank Accession Number | BC126219 |
| Gene Symbol | SAFB |
| Gene ID (NCBI) | 6294 |
| RRID | AB_2878928 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15424 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Heterogeneous nuclear ribonucleoproteins (hnRNPs) constitute a set of polypeptides that contribute to pre-mRNA processing and transport. hnRNPs also bind heterogeneous nuclear RNA (hnRNA), the transcripts produced by RNA polymerase II. SAFB (scaffold attachment factor B) is a nuclear matrix-associated protein that binds to matrix- or scaffold-associating regions (MARs or SARs) on DNA and interacts with RNA polymerase II and serine-/arginine-rich RNA processing factors (SR proteins). SAFB, also designated HAP (hnRNP A1 associated protein) and HET (HSP 27-ERE-TATA-binding protein) is a proven hnRNP protein that has a speckled distribution in the nucleus and, in response to stress agents such as heat shock, is recruited to a few, large nuclear granules, called perichromatin granules. SAFB also binds to the estrogen receptor (ER) and is expressed in several breast cancer cell lines at varying levels. Subsequently, SAFB may play a role in breast cancer by mediating cellular proliferation and division. This antibody specifically reacts whith the isoform 1 of human SAFB protein. SF3A1, also known as SF3a120, is a 793 amino acid protein, which is a Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. SF3A1 also be involved in the assembly of the 'E' complex. The calculated molecular weight of SAFB is 103 kDa, but the modified SAFB is about 130-175 kDa.(PMID: 28469965, PMID: 26273616 )
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SAFB antibody 21857-1-AP | Download protocol |
| IHC protocol for SAFB antibody 21857-1-AP | Download protocol |
| WB protocol for SAFB antibody 21857-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SAFB Polyclonal antibody (Cat# 21857-1-AP) has 10 citations across journals including Cell, Autophagy, Mol Cell, Cell Death & Disease, Cell Reports, J Med Chem, Acta Neuropathol Commun, Neurobiology of Disease, and Nature Communications. Research fields span epitranscriptomics (m⁶A), autophagy, chromatin/transcription regulation, esophageal cancer, RNA splicing and neurodegeneration (ALS/FUS), antiviral defense, thermal stress granules, nuclear stress bodies, and preimplantation development.
| Species | Application | Title |
|---|---|---|
Cell FOCAS: Transcriptome-wide screening of individual m(6)A sites functionally dissects epitranscriptomic control of gene expression in cancer. | ||
Autophagy WNT2B impairs endosomal trafficking via WASHC5 to inhibit autophagy: a novel non-secretory WNT pathway. | ||
Mol Cell SAFB restricts contact domain boundaries associated with L1 chimeric transcription | ||
Cell Death Dis USP5 regulates purine metabolism and represents a therapeutic target in esophageal cancer. | ||
Cell Rep PATZ1 condensation adjacent to PML nuclear bodies suppresses HBoV transcription as an intrinsic antiviral defense. | ||
Cell Rep Stress-induced TDP-43 nuclear condensation causes splicing loss of function and STMN2 depletion |
Reviews
What customers say
Customers rate this SafB antibody highly (mostly 4–5 stars) across Western blot, immunoprecipitation, and immunofluorescence. In WB it reliably detects the expected ~150 kDa SafB band in mESCs, HEK293T, RKO, and primary astrocytes, typically at 1:1000–1:5000 dilution. Some users note occasional non-specific bands (e.g., ~75 kDa) or ladder staining, but overall signal quality is considered good. It performs well for IP and for immunocytochemistry, including detection of nuclear stress bodies (nSBs) in HeLa cells. Overall, reviewers find it specific and effective for SafB detection.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Moritz (Verified Customer) (09-26-2025) | worked well for the detection of mouse safb protein
 |
Aleksandr (Verified Customer) (12-16-2024) | Antibody does recognise the band of the expected molecular weight of SafB protein, however other non-specific bands are also visible
 |
Tsimafei (Verified Customer) (11-19-2024) | Antibody detect a band below 150 kDa in HEK293T cells
 |
Izortze (Verified Customer) (10-02-2024) | Great antibody for immunoprecipitation!
 |
Julia (Verified Customer) (08-07-2024) | Used antibody for mESC protein extract. Band of the correct size is visible, additional band at ~75kDa. Stains ladder but otherwise good.
 |
Tatyana (Verified Customer) (12-04-2023) | Good signal in ICC, can be used to detect nuclear stress bodies (nSBs)
 |
Bibha (Verified Customer) (06-05-2019) | I used this antibody in human primary astrocytes Mock-infected or infected with Venezuelan equine encephalitis virus.
 |
