RNF7 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 68656-1-Ig (same clone as 68656-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68656-1-Ig (RNF7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68656-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51464-1

  Cytometric bead array sample test of MP51464-1, SAG Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68656-1-PBS. Detection antibody: 68656-2-PBS.

• 

  Cytometric bead array standard curve of MP51464-1

  Cytometric bead array standard curve of MP51464-1, SAG Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68656-1-PBS. Detection antibody: 68656-2-PBS. Standard:Ag16903. Range: 0.391-50 ng/mL.

RNF7 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 68656-1-PBS

Clone No.1A9E7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

1A9E7, CKBBP1, CKII beta-binding protein 1, RBX2, RING-box protein 2

---

Product Information

68656-1-PBS targets RNF7 as part of a matched antibody pair:

MP51464-1: 68656-1-PBS capture and 68656-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16903

  Product name: Recombinant human SAG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-113 aa of BC008627

  Sequence: MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

• Full Name: ring finger protein 7
• Calculated Molecular Weight: 113 aa, 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC008627
• Gene Symbol: RNF7
• Gene ID (NCBI): 9616
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UBF6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RNF (ring finger protein 7 ) is a novel zinc RING finger protein which is redox responsive and protects mammalian cells from apoptosis.It is shown to be localised in the cytoplasmand nucleus of the cell and is expressed in the heart, liver, skeletal muscle predominantly. RNF7 forms oligomers(55 kDa),dimer(28 kDa) and monomer(13 kDa) in the presence of different concentrations of the reductant.