SALL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SALL2 Polyclonal antibody (12679-1-AP)

SALL2 Polyclonal Antibody for WB, ELISA

Cat No. 12679-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

HSAL2, KIAA0360, Sal like protein 2, SAL2, Sal-2

• 

  WB analysis of HEK-293 using 12679-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12679-1-AP (SALL2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SALL2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12679-1-AP targets SALL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3367

  Product name: Recombinant human SALL2 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-198 aa of BC024245

  Sequence: MAHESERSSRLGVPCGEPAELGGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESPGHFLVAATEPVCGIPVKWPAHEALEFQLHLHYHSKPGPTSAVWPRNCGWEGASNNGIQGSQGEDSPPPISASCTQGSA

• Full Name: sal-like 2 (Drosophila)
• Calculated Molecular Weight: 1007 aa, 105 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC024245
• Gene Symbol: SALL2
• Gene ID (NCBI): 6297
• RRID: AB_2183243
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y467
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SALL4 antibody (Cat# 12679-1-AP) has 3 citations. They appear in Nature Communications, Cancer Biology & Therapy, and Scientific Reports. The research fields span cancer biology, including T cell exhaustion in hepatocellular carcinoma, ferroptosis in breast cancer, and stem cell-like properties in glioblastoma.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Oncofetal gene SALL4 reactivation by hepatitis B virus counteracts miR-200c in PD-L1-induced T cell exhaustion.; Authors - Cheng Sun
		Cancer Biol Ther; NSUN2 mediates SALL2 m5C methylation to inhibit ferroptosis and promote breast cancer progression.; Authors - Jiawei Li
human	WB	Sci Rep; Targeting PTPRZ inhibits stem cell-like properties and tumorigenicity in glioblastoma cells.; Authors - Akihiro Fujikawa