SALL2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67522-1-Ig (same clone as 67522-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67522-1-Ig (SALL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67522-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCCIT using 67522-1-Ig (same clone as 67522-1-PBS)

  NCCIT cells were subjected to SDS PAGE followed by western blot with 67522-1-Ig (SALL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67522-1-PBS in a different storage buffer formulation.

SALL2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67522-1-PBS

Clone No.3B6G2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Sal-2, SAL2, Sal like protein 2, KIAA0360, HSAL2

---

Product Information

67522-1-PBS targets SALL2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30007

  Product name: Recombinant human SALL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-198 aa of BC024245

  Sequence: MAHESERSSRLGVPCGEPAELGGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESPGHFLVAATEPVCGIPVKWPAHEALEFQLHLHYHSKPGPTSAVWPRNCGWEGASNNGIQGSQGEDSPPPISASCTQGSA

• Full Name: sal-like 2 (Drosophila)
• Calculated Molecular Weight: 1007 aa, 105 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC024245
• Gene Symbol: SALL2
• Gene ID (NCBI): 6297
• RRID: AB_2882742
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y467
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sall2 (SALL2, sal-like 2, HSAL2, p150(Sal2)) are mammalian homologs of the Drosophila region-specific home-otic gene spalt (sal), which encodes a zinc finger- containing transcription regulator. Mammalian Sall1 may mediate higher order chromatin structure and may be a component of a distinct heterochromatin-dependent silencing process. Sall2 is a p53-independent regulator of p21 and BAX, and can function in some cell types as a regulator of cell survival. Human Sall2 is present in brain, heart, kidney and pancreas.