SAMD4A Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86530-1-RR (same clone as 86530-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86530-1-RR (SAMD4A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86530-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86530-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86530-1-RR against Human SAMD4A were performed. The affinity constant is 2.33 nM.

SAMD4A Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86530-1-PBS

Clone No.251369F11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

hSmaug1, KIAA1053, Protein Smaug homolog 1, SAM domain-containing protein 4A, SAMD4

---

Product Information

86530-1-PBS targets SAMD4A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11273

  Product name: Recombinant human SAMD4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-383 aa of BC021726

  Sequence: LLNPYQAAAWDSICPIHWRLTDIIEGGSLRIPLQELHQMILTPIKAYSSPSTTPEARRREPQAPRQPSLMGPESQSPDCKDGAAATGATATPSAGASGGLQPHQLSSCDGELAVAPLPEGDLPGQFTRVMGKVCTQLLVSRPDEENISSYLQLIDKCLIHEAFTETQKKRLLSWKQQVQKLFRSFPRKTLLDISGYRQQRNRGFGQSNSLPTAGSVGGGMGRRNPRQYQIPSRNVPSARLGLLGTSGFVSSNQRNTTATPTIMKQGRQNLWFANPGGSNSMPSRTHSSVQRTRSLPVHTSPQNMLMFQQPGSQVHSGLCLTDLRGWLSLSGAPSMPALTVPKSSQGEFQLPVTEPDINNRLESLCLSMTEHALGDGVDRTSTI

• Full Name: sterile alpha motif domain containing 4A
• Calculated Molecular Weight: 529 aa, 59 kDa
• Observed Molecular Weight: 70-71 kDa
• GenBank Accession Number: BC021726
• Gene Symbol: SAMD4A
• Gene ID (NCBI): 23034
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UPU9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SAMD4A is also named as KIAA1053, SAMD4, SMAUG1, hSmaug1 and belongs to the SMAUG family. SAMD4A acts as a translational repressor of SRE-containing messengers. (PMID:16221671). In particular, as orthologous alternative splicing isoforms, mouse Samd4a E-form and human SAMD4A C-form containing the SAM domain were specific to testes. Samd4a/SAMD4A plays an essential role in normal spermatogenesis, and SAMD4A, as a spermatid specific marker, can be used for subcategorizing nonobstructive azoospermia patients (PMID:36274854). In mammalian cells, human SAMD4A can form a kind of mRNA‐silencing foci in the cytoplasm, acting differently from processing body and stress granules. Recently, it was reported that human SAMD4A can protect the host from viral infection by degrading viral RNA (PMID: 32341522). Indition, 14-3-3s negatively regulate the localization of the RNA-binding protein SAMD4A to cytoplasmic granules and inhibit its activity as a translational repressor (PMID: 36931259).