SAMD8 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SAMD8 Recombinant monoclonal antibody, PBS Only (86670-1-PBS)

• 

  WB analysis using 86670-1-RR (same clone as 86670-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86670-1-RR (SAMD8 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86670-1-PBS in a different storage buffer formulation.

SAMD8 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86670-1-PBS

Clone No.251533B11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Ceramide phosphoethanolamine synthase, CPE synthase, EC:2.7.8.-, SAM domain-containing protein 8, Sphingomyelin synthase-related protein 1

---

Product Information

86670-1-PBS targets SAMD8 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25310

  Product name: Recombinant human SAMD8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-152 aa of BC146556

  Sequence: MAGPNQLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTDWLCNGELSHDCDGPITDLNSDQYQYMNGKNKHSVRRLDPEYWKT

• Full Name: sterile alpha motif domain containing 8
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC146556
• Gene Symbol: SAMD8
• Gene ID (NCBI): 142891
• RRID: AB_3745044
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96LT4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.