SAMSN1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SAMSN1 Polyclonal antibody (13063-1-AP)

• Featured Product
• KD/KO Validated

SAMSN1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13063-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

SH3-SAM adaptor protein, SH3D6B, SH3 SAM adaptor protein, SAM domain-containing protein SAMSN-1, HACS1

• 

  WB analysis of K-562 using 13063-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13063-1-AP (SAMSN1 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 13063-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13063-1-AP (SAMSN1 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of K-562 using 13063-1-AP

  IP result of anti-SAMSN1 (IP:13063-1-AP, 4ug; Detection:13063-1-AP 1:1000) with K-562 cells lysate 4000 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 13063-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13063-1-AP (SAMSN1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 13063-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13063-1-AP (SAMSN1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 13063-1-AP

  Immunofluorescent analysis of HepG2 cells using 13063-1-AP (SAMSN1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SAMSN1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13063-1-AP targets SAMSN1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3755

  Product name: Recombinant human SAMSN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-373 aa of BC029112

  Sequence: MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPSD

• Full Name: SAM domain, SH3 domain and nuclear localization signals 1
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42-50 kDa
• GenBank Accession Number: BC029112
• Gene Symbol: SAMSN1
• Gene ID (NCBI): 64092
• RRID: AB_2877910
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NSI8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SAMSN1 Polyclonal antibody (Cat# 13063-1-AP) has 4 citations. They appear in Molecular & Cellular Proteomics, Annals of Surgical Oncology, Stem Cells International, and Oncology Letters. The research fields span epigenetic signatures in macrophage activation, hepatocellular carcinoma malignancy, hippocampal neural stem cell proliferation and differentiation, and prognostic relevance in gastric cancer. Applications cited include WB and IHC in human and mouse samples.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell Proteomics; Multi-Level Proteomics Reveals Epigenetic Signatures in BCG-mediated Macrophage Activation; Authors - Zoe Schaefer
human	IHC	Ann Surg Oncol; Suppression of SAMSN1 Expression is Associated with the Malignant Phenotype of Hepatocellular Carcinoma.; Authors - Satoshi Sueoka
mouse	WB	Stem Cells Int; Lama2 And Samsn1 Mediate the Effects of Brn4 on Hippocampal Neural Stem Cell Proliferation and Differentiation; Authors - Lei Zhang ; KD Validated
human	IHC	Oncol Lett; Prognostic relevance of SAMSN1 expression in gastric cancer.; Authors - Mitsuro Kanda