SAP102 Monoclonal antibody, PBS Only

• 

  WB analysis of pig brain using 67102-1-Ig (same clone as 67102-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67102-1-Ig (SAP102 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67102-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse cerebellum using 67102-1-Ig (same clone as 67102-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 67102-1-Ig (SAP102 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67102-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67102-1-Ig (same clone as 67102-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67102-1-Ig (SAP102 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67102-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67102-1-Ig (same clone as 67102-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67102-1-Ig (SAP102 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67102-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67102-1-Ig (same clone as 67102-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67102-1-Ig (SAP102 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67102-1-PBS in a different storage buffer formulation.

SAP102 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67102-1-PBS

Clone No.1F6A10

Host / Isotype

Mouse / IgG1

Reactivity

Human, Pig, Mouse, Rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Disks large homolog 3, DLG3, KIAA1232, MRX, MRX90, NE Dlg, NEDLG, Neuroendocrine DLG, SAP 102, SAP102, Synapse associated protein 102, XLMR

---

Product Information

67102-1-PBS targets SAP102 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, Pig, Mouse, Rat samples.

• Tested Reactivity: Human, Pig, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28589

  Product name: Recombinant human DLG3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 466-817 aa of BC093864

  Sequence: RPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL

• Full Name: discs, large homolog 3 (Drosophila)
• Calculated Molecular Weight: 817 aa, 90 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC093864
• Gene Symbol: SAP102
• Gene ID (NCBI): 1741
• RRID: AB_2882407
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q92796
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Synapse-associated protein 102 (SAP102), also known as DLG3, is a MAGUK that is highly expressed early in development and mediates receptor trafficking during synaptogenesis. The importance of SAP102 function in brain development is demonstrated by the fact that SAP102 mutations have been identified in human patients with nonsyndromic X-linked mental retardation (XLMR).SAP102 has critical roles in early cortical synapse development.