SAP30 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SAP30 Polyclonal antibody (27679-1-AP)

SAP30 Polyclonal Antibody for WB, ELISA

Cat No. 27679-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IF, ELISA

Synonyms

SAP30

• 

  WB analysis of A549 using 27679-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 27679-1-AP (SAP30 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 27679-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 27679-1-AP (SAP30 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 27679-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 27679-1-AP (SAP30 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SAP30 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HL-60 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27679-1-AP targets SAP30 in WB, IF, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26516

  Product name: Recombinant human SAP30 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 68-197 aa of BC016757

  Sequence: CLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTL

• Full Name: Sin3A-associated protein, 30kDa
• Calculated Molecular Weight: 220 aa, 23 kDa
• Observed Molecular Weight: 23-28 kDa
• GenBank Accession Number: BC016757
• Gene Symbol: SAP30
• Gene ID (NCBI): 8819
• RRID: AB_2880945
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75446
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SAP30, also named as Sin3 corepressor complex subunit SAP30, is a 220 amino acid protein, which is expressed in all tissues tested with highest levels in pancreas, ovary, PBL, spleen and thymus. SAP30 is involved in the functional recruitment of the Sin3-histone deacetylase complex (HDAC) to a specific subset of N-CoR corepressor complexes.

Publications

What published studies show

The SAP30 Polyclonal antibody (Cat# 27679-1-AP) has 4 total citations. These appear in Nature Communications, Cell Death & Disease, Cell Reports, and Development. The associated research fields include hypoxia-induced chromatin reprogramming and anti-inflammatory signaling, Hippo pathway dysregulation and oncogenic YAP1 activation, pre-mRNA splicing regulation, and mucociliary epithelial differentiation. All citations involve human samples, with applications in Western blotting and immunofluorescence.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Chondrocytes reprogram chromatin in hypoxic microenvironments to activate CADM1-AS1/HDAC1 complex-mediated anti-inflammation signals.; Authors - Weiyu Ni
human	WB	Cell Death Dis; Loss of FAM60A disrupts Sin3/HDAC control of the Hippo signaling and promotes oncogenic YAP1 activation.; Authors - Mojnu Miah
human	WB	Cell Rep; SAP30BP interacts with RBM17/SPF45 to promote splicing in a subset of human short introns; Authors - Kazuhiro Fukumura
	IF	Development; Novel dynamics of human mucociliary differentiation revealed by single-cell RNA sequencing of nasal epithelial cultures.; Authors - Sandra Ruiz García