SAP30BP Polyclonal antibody

• 

  WB analysis of mouse spleen using 20943-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 20943-1-AP (SAP30BP Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

SAP30BP Polyclonal Antibody for WB, ELISA

Cat No. 20943-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF, IP, ELISA

Synonyms

HTRG, HTRP, SAP30-binding protein

---

Tested Applications

• Positive WB detected in: mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

20943-1-AP targets SAP30BP in WB, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15051

  Product name: Recombinant human SAP30BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-308 aa of BC007592

  Sequence: MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ

• Full Name: SAP30 binding protein
• Calculated Molecular Weight: 308 aa, 34 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC007592
• Gene Symbol: SAP30BP
• Gene ID (NCBI): 29115
• RRID: AB_2878770
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHR5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SAP30BP, also named as SAP30-binding protein, is a 308 amino acid protein, which belongs to the HCNGP family. SAP30BP localizes in Nucleus and Interacts with SAP30. DDX54 Induces cell death and may act as a transcriptional corepressor of a gene related to cell survival. SAP30BP may be involved in the regulation of beta-2-microglobulin genes.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP,IF	EMBO J; CDK11 requires a critical activator SAP30BP to regulate pre-mRNA splicing; Authors - Changshou Wang ; KD Validated
		Cell Insight; The methyltransferase SETD3 regulates mRNA alternative splicing through interacting with hnRNPK; Authors - Yue-Yu Kong