SAPS1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SAPS1 Polyclonal antibody, PBS Only (17819-1-PBS)

• 

  WB analysis of HeLa using 17819-1-AP (same clone as 17819-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 17819-1-AP (SAPS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17819-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 17819-1-AP (same clone as 17819-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17819-1-AP (SAPS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17819-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 17819-1-AP (same clone as 17819-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 17819-1-AP (SAPS1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17819-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 17819-1-AP (same clone as 17819-1-PBS)

  IP result of anti-SAPS1 (IP:17819-1-AP, 4ug; Detection:17819-1-AP 1:1000) with HeLa cells lysate 3200ug. This data was developed using the same antibody clone with 17819-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17819-1-AP (same clone as 17819-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17819-1-AP (SAPS1 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 17819-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17819-1-AP (same clone as 17819-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17819-1-AP (SAPS1 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 17819-1-PBS in a different storage buffer formulation.

SAPS1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 17819-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

17819-1-PBS targets SAPS1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12149

  Product name: Recombinant human SAPS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 532-881 aa of BC094753

  Sequence: DDEDDRLKEFNFPEEAVLQQAFMDFQMQRMTSAFIDHFGFNDEEFGEQEESVNAPFDKTANITFSLNADDENPNANLLEICYKDRIQQFDDDEEEEDEEEAQGSGESDGEDGAWQGSQLARGARLGQPPGVRSGGSTDSEDEEEEDEEEEEDEEGIGCAARGGATPLSYPSPGPQPPGPSWTATFDPVPTDAPTSPRVSGEEELHTGPPAPQGPLSVPQGLPTQSLASPPARDALQLRSQDPTPPSAPQEATEGSKVTEPSAPCQALVSIGDLQATFHGIRSAPSSSDSATRDPSTSVPASGAHQPPQTTEGEKSPEPLGLPQSQSAQALTPPPIPNGSAPEGPASPGSQ

• Full Name: SAPS domain family, member 1
• Calculated Molecular Weight: 881aa,97 kDa; 943aa,103 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC094753
• Gene Symbol: SAPS1
• Gene ID (NCBI): 22870
• RRID: AB_2183809
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPN7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.