SARM1 Polyclonal antibody

• 

  WB analysis using 28625-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28625-1-AP (SARM1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 28625-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28625-1-AP (SARM1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 28625-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28625-1-AP (SARM1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of SH-SY5Y using 28625-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using SARM1 antibody (28625-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of SH-SY5Y using 28625-1-AP

  1x10^6 SH-SY5Y cells were intracellularly stained with 0.25 ug SARM1 Polyclonal antibody (28625-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00017).

SARM1 Polyclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 28625-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

EC:3.2.2.-, EC:3.2.2.6, FLJ36296, hSARM1, HsTIR

---

Tested Applications

• Positive WB detected in: Daudi cells, HEK-293 cells, Neuro-2a cells, Raji cells, human testis tissue, SH-SY5Y cells, mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: SH-SY5Y cells
• Positive FC (Intra) detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

28625-1-AP targets SARM1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29531

  Product name: Recombinant human SARM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 352-573 aa of NM_015077

  Sequence: EAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSG

• Full Name: sterile alpha and TIR motif containing 1
• Calculated Molecular Weight: 79 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: NM_015077
• Gene Symbol: SARM1
• Gene ID (NCBI): 23098
• RRID: AB_3086070
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6SZW1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SARM1 (sterile alpha and Toll/interleukin-1 receptor motif-containing 1) is also named as KIAA0524, SAMD2 and SARM. SARM1 is the major pro-degenerative protein in axons (PMID: 32152523). SARM1 is the central executioner of pathological axon degeneration and is an inducible NAD+-cleavage enzyme that is activated by the loss of the NAD+ biosynthetic enzyme NMNAT2 (PMID: 33657413). SARM1 is involved in innate immune response: inhibits both TICAM1/TRIF- and MYD88-dependent activation of JUN/AP-1, TRIF-dependent activation of NF-kappa-B and IRF3, and the phosphorylation of MAPK14/p38 (PMID: 16964262).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Neurosci Res; SARM1 is essential for NMDA receptor-dependent endocytosis of AMPA receptors in hippocampal neurons; Authors - Misaki Morishita

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Anam (Verified Customer) (09-03-2025)

For IF and ICC it works really well

• Applications: Western Blot, Immunohistochemistry, Flow Cytometry, Cell culture
• Primary Antibody Dilution: 1:200 or 1:1000
• Cell Tissue Type: Schwann cells, Stem cells