Tested Applications
| Positive WB detected in | Daudi cells, HEK-293 cells, Neuro-2a cells, Raji cells, human testis tissue, SH-SY5Y cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SH-SY5Y cells |
| Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28625-1-AP targets SARM1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29531 Product name: Recombinant human SARM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 352-573 aa of NM_015077 Sequence: EAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSG Predict reactive species |
| Full Name | sterile alpha and TIR motif containing 1 |
| Calculated Molecular Weight | 79 kDa |
| Observed Molecular Weight | 70-80 kDa |
| GenBank Accession Number | NM_015077 |
| Gene Symbol | SARM1 |
| Gene ID (NCBI) | 23098 |
| RRID | AB_3086070 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6SZW1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SARM1 (sterile alpha and Toll/interleukin-1 receptor motif-containing 1) is also named as KIAA0524, SAMD2 and SARM. SARM1 is the major pro-degenerative protein in axons (PMID: 32152523). SARM1 is the central executioner of pathological axon degeneration and is an inducible NAD+-cleavage enzyme that is activated by the loss of the NAD+ biosynthetic enzyme NMNAT2 (PMID: 33657413). SARM1 is involved in innate immune response: inhibits both TICAM1/TRIF- and MYD88-dependent activation of JUN/AP-1, TRIF-dependent activation of NF-kappa-B and IRF3, and the phosphorylation of MAPK14/p38 (PMID: 16964262).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SARM1 antibody 28625-1-AP | Download protocol |
| IHC protocol for SARM1 antibody 28625-1-AP | Download protocol |
| WB protocol for SARM1 antibody 28625-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SARM1 antibody (Cat# 28625-1-AP) has 7 total citations published in Cell, Advanced Science, Journal of Ethnopharmacology, CNS Neuroscience & Therapeutics, Neuroscience Research, and Bioorganic Chemistry. Research fields span mitochondrial homeostasis and redox biology, gastric cancer radioresistance, peripheral neuropathy, neurodegeneration (Alzheimer's), synaptic receptor trafficking, and metabolic signaling pathways. Applications include WB and IF in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) TPI1 Loss Triggers a Metabolite-Driven Mitochondrial Redox Vulnerability via the SARM1-cADPR-Ca(2+) Axis. | ||
Adv Sci (Weinh) Radiation-Induced Tumor-Intrinsic LTβR N-Glycosylation Suppresses Pyroptosis Through TRIM28-Mediated PCBP2 SUMOylation to Promote Gastric Cancer Radioresistance | ||
J Ethnopharmacol Combined analysis of network pharmacology and transcriptomics deciphers the pharmacological mechanism of Huangqi Guizhi Wuwu decoction attenuates Oxaliplatin-induced peripheral neuropathy via regulating Sirt1 | ||
CNS Neurosci Ther hUC-MSCs via β-NGF Alleviate Cognitive Impairment After Tibial Fracture Surgery by Regulating the STMN2/NMNAT2-SARM1-NF-κB Signaling Pathway. | ||
Neurosci Res SARM1 is essential for NMDA receptor-dependent endocytosis of AMPA receptors in hippocampal neurons |
Reviews
What customers say
One verified user rated this product 5 out of 5 stars (September 2025). The reviewer tested it on Schwann cells and stem cells at dilutions of 1:200 or 1:1000, reporting excellent performance for immunofluorescence and immunocytochemistry. The reviewer also listed Western Blot, immunohistochemistry, flow cytometry, and cell culture among the applications used. Overall, the feedback is highly positive, highlighting reliable staining results across multiple techniques.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Anam (Verified Customer) (09-03-2025) | For IF and ICC it works really well
|
