SASH3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SASH3 Polyclonal antibody, PBS Only (31915-1-PBS)

• 

  WB analysis using 31915-1-AP (same clone as 31915-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31915-1-AP (SASH3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31915-1-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 31915-1-AP (same clone as 31915-1-PBS)

  WB result of SASH3 antibody (31915-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SASH3 transfected THP-1 cells. This data was developed using the same antibody clone with 31915-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SASH3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31915-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CXorf9, SAM and SH3 domain-containing protein 3, SH3 protein expressed in lymphocytes homolog, SLY

---

Product Information

31915-1-PBS targets SASH3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36154

  Product name: Recombinant human SASH3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 230-380 aa of BC051881

  Sequence: DVLPEEAVGHARPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRDDAELAGTEEQLQGLSLAGAP

• Full Name: SAM and SH3 domain containing 3
• Calculated Molecular Weight: 380 aa, 42 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC051881
• Gene Symbol: SASH3
• Gene ID (NCBI): 54440
• RRID: AB_3742493
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75995
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sterile alpha motif (SAM) and Src homology-3 (SH3) domain-containing 3 (SASH3), also called SH3-containing lymphocyte protein (SLY1), is a putative adaptor protein that is postulated to play an important role in the organization of signaling complexes and propagation of signal transduction cascades in lymphocytes. The SASH3 gene is located on the X-chromosome, which plays an important role in human lymphocyte function and survival (PMID: 33876203).