Use Able AI chat for product recommendations

SATB2 Polyclonal antibody

SATB2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30717-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

DNA binding protein SATB2, DNA-binding protein SATB2, FLJ21474, FLJ32076, KIAA1034

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, mouse brain tissue
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30717-1-AP targets SATB2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag33523

Product name: Recombinant human SATB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 674-733 aa of BC098136

Sequence: GKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENADKSKAAPAEIDQR

Predict reactive species
Full Name SATB homeobox 2
Calculated Molecular Weight 733 aa, 83 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC098136
Gene Symbol SATB2
Gene ID (NCBI) 23314
RRIDAB_3742369
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UPW6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SATB2, also named as KIAA1034, belongs to the CUT homeobox family. SATB2 binds to DNA at nuclear matrix- or scaffold-associated regions. STAB2 recognizes the sugar-phosphate structure of double-stranded DNA. SATB2 is a transcription factor controlling nuclear gene expression, by binding to matrix attachment regions (MARs) of DNA and inducing a local chromatin-loop remodeling. SATB2 acts as a docking site for several chromatin remodeling enzymes and also by recruiting corepressors (HDACs) or coactivators (HATs) directly to promoters and enhancers. It is required for the initiation of the upper-layer neurons (UL1) specific genetic program and for the inactivation of deep-layer neurons (DL) and UL2 specific genes, probably by modulating BCL11B expression. It is a repressor of Ctip2 and regulatory determinant of corticocortical connections in the developing cerebral cortex. SATB2 may play an important role in palate formation. SATB2 acts as a molecular node in a transcriptional network regulating skeletal development and osteoblast differentiation.

Protocols

Product Specific Protocols
IHC protocol for SATB2 antibody 30717-1-APDownload protocol
WB protocol for SATB2 antibody 30717-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...