SBDS Polyclonal antibody

• 

  WB analysis using 17618-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17618-1-AP (SBDS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 17618-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 17618-1-AP (SBDS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 17618-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 17618-1-AP (SBDS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HL-60 using 17618-1-AP

  IP result of anti-SBDS (IP:17618-1-AP, 4ug; Detection:17618-1-AP 1:300) with HL-60 cells lysate 3040ug.

• 

  IHC staining of human pancreas cancer using 17618-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 17618-1-AP (SBDS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 17618-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 17618-1-AP (SBDS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SBDS Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 17618-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

CGI 97, SBDS, SDS, SWDS

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HL-60 cells, SH-SY5Y cells, HEK-293T cells
• Positive IP detected in: HL-60 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

17618-1-AP targets SBDS in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11814

  Product name: Recombinant human SBDS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-250 aa of BC065700

  Sequence: MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE

• Full Name: Shwachman-Bodian-Diamond syndrome
• Calculated Molecular Weight: 250 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC065700
• Gene Symbol: SBDS
• Gene ID (NCBI): 51119
• RRID: AB_2184481
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3A5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Shwachman-Bodian-Diamond syndrome (SBDS) is a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The protein may function in RNA metabolism. Mutations within its gene are associated with Shwachman-Bodian-Diamond syndrome.This gene encodes a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The encoded protein may function in RNA metabolism. Mutations within this gene are associated with Shwachman-Bodian-Diamond syndrome. An alternative transcript has been described, but its biological nature has not been determined. This gene has a closely linked pseudogene that is distally located. This antibody is a rabbit polyclonal antibody raised against a full-length human SBDS protein, recognizes specifically the 29kd SBDS protein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncogenesis; The HIF/PHF8/AR axis promotes prostate cancer progression.; Authors - D Tong
rat	WB	Brain Res Bull; Cerebral ischemia-reperfusion causes a down regulation of HCN1 expression via enhancing the nuclear NRSF-HDAC4 gathering that contributes to neuron damage.; Authors - Pan Luo
human	IHC,IF	Am J Transl Res; Three RNA-binding protein signature as a novel biomarker to predict endometrial cancer prognosis; Authors - Bo Wang
human	WB	Cancer Res; A Genome-Wide Synthetic Lethal Screen Identifies Spermidine Synthase as a Target to Enhance Erdafitinib Efficacy in FGFR-Mutant Bladder Cancer; Authors - Yanchao Yu