SCAMP1 Polyclonal antibody

• 

  WB analysis of mouse brain using 15327-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15327-1-AP (SCAMP1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15327-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15327-1-AP (SCAMP1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 15327-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 15327-1-AP (SCAMP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 15327-1-AP

  IP result of anti-SCAMP1 (IP:15327-1-AP, 4ug; Detection:15327-1-AP 1:1000) with mouse brain tissue lysate 3200 ug.

• 

  IHC staining of mouse brain using 15327-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15327-1-AP (SCAMP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 15327-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15327-1-AP (SCAMP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 15327-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15327-1-AP (SCAMP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 15327-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15327-1-AP (SCAMP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SCAMP1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 15327-1-AP

Publications(4)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

SCAMP, SCAMP1, SCAMP37

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HeLa cells, mouse pancreas tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue, human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 2 publications below
• IP: See 1 publications below

Product Information

15327-1-AP targets SCAMP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3258

  Product name: Recombinant human SCAMP1 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-338 aa of BC034048

  Sequence: MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAASSAAQNAFKGNQI

• Full Name: secretory carrier membrane protein 1
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC034048
• Gene Symbol: SCAMP1
• Gene ID (NCBI): 9522
• RRID: AB_2184766
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15126
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Int J Mol Sci; Multiomics Analysis of Endocytosis upon HBV Infection and Identification of SCAMP1 as a Novel Host Restriction Factor against HBV Replication.; Authors - Tanzeel Yousaf
human	IHC	Cell Death Dis; MTSS1 and SCAMP1 cooperate to prevent invasion in breast cancer.; Authors - Jayakumar Vadakekolathu
human	WB	Aging (Albany NY); Expression and prognostic analyses of SCAMPs in pancreatic adenocarcinoma.; Authors - Feiyu Mao
human	WB,IHC	J Cancer; SCAMP1 silencing inhibits proliferation by attenuating multiple pro-survival signaling pathways in gastric cancer; Authors - Gang Ma

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Olga (Verified Customer) (01-17-2025)

Works perfectly in Western. Gives a clear single band of the corresponding size in almost all tissues and cell lines tested. Recognizes mouse and human Scamp1.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse tissues (heart, lung, liver, forebrain), mouse primary cerebellar neurons, Neuro2A, HEK293T

SCAMP1 Antibody Western Blot validation (1:1000 dilution) in Mouse tissues (heart, lung, liver, forebrain), mouse primary cerebellar neurons, Neuro2A, HEK293T (Cat no:15327-1-AP)