Tested Applications
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12266-1-AP targets SCAP in WB, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2937 Product name: Recombinant human SCAP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 601-905 aa of BC020987 Sequence: LQGNLIVVGRSSGRLEVWDAIEGVLCCSSEEVSSGITALVFLDKRIVAARLNGSLDFFSLETHTALSPLQFRGTPGRGSSPASPVYSSSDTVACHLTHTVPCAHQKPITALKAAAGRLVTGSQDHTLRVFRLEDSCCLFTLQGHSGAITTVYIDQTMVLASGGQDGAICLWDVLTGSRVSHVFAHRGDVTSLTCTTSCVISSGLDDLISIWDRSTGIKFYSIQQDLGCGASLGVISDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVCNFGSELSLVYVPSVLEKLD Predict reactive species |
| Full Name | SREBF chaperone |
| Calculated Molecular Weight | 1279 aa, 140 kDa |
| Observed Molecular Weight | 140 kDa |
| GenBank Accession Number | BC020987 |
| Gene Symbol | SCAP |
| Gene ID (NCBI) | 22937 |
| RRID | AB_10697683 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12770 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SCAP is a regulatory protein that is required for the proteolytic cleavage of the sterol regulatory element-binding protein (SREBP). SCAP is an integral membrane protein located in the endoplasmic reticulum (ER). One of the cytosolic regions of SCAP contains a hexapeptide amino acid sequence, MELADL, that functions to detect cellular cholesterol. When cholesterol is present, SCAP undergoes a conformational change that prevents it from activating SREBP and cholesterol synthesis does not occur. SCAP has 4 isoforms with MW 140, 98, 96 and 85 kDa (refer to UniProt: Q12770).
Publications
What published studies show
Anti-SCAP (Cat# 12266-1-AP) has 12 citations across journals including Advanced Science, Cell Death & Disease, PNAS, Cell Reports, EMBO Reports, Scientific Reports, PLoS Pathogens, FASEB Journal, and Biochemical and Biophysical Research Communications. Research fields span cholesterol/lipid metabolism, cancer (prostate, gastric), ferroptosis, diabetes-associated neuroinflammation, insulin signaling, fatty acid synthesis, viral infection, mechanotransduction, and fatty liver disease.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Functional Suppression of SCAP Triggers Endoplasmic Reticulum Stress-Dependent Ferroptosis by Impairing Cholesterol Metabolism in Gastric Cancer. | ||
Adv Sci (Weinh) A Super-Enhancer-Driven Transcriptional Regulatory Circuit Underlying Abiraterone Resistance in Castration-Resistant Prostate Cancer | ||
Adv Sci (Weinh) HMGCR-Driven Cholesterol Metabolism Promotes Osteoarthritis Progression by Accelerating Synovial Fibroblast Senescence. | ||
Cell Death Dis Astrocytic SCAP deletion ameliorates diabetes-associated cognitive impairment by suppressing microglial neuroinflammation and lipid droplet accumulation via the LCN2-24p3R-mTOR axis. | ||
Cell Rep Scap stabilizes PKM2 to promote glycolysis and enhance anti-fungal immunity in macrophages. |
Reviews
What customers say
Customers consistently rate this SCAP antibody highly across multiple applications. Western blot users report strong performance at a 1:1000 dilution, describing it as very good quality. Immunoprecipitation at 1:600 also yielded excellent results. One user achieved nice staining in human colon cancer tissue sections via IHC at 1:100. Overall, reviewers highlight reliable performance and good quality for both blotting and IP applications, with an average rating of 4.75 out of 5 stars across four reviews.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura (Verified Customer) (03-23-2026) | SCAP antibody works very good
|
Sai Sindhura (Verified Customer) (01-08-2026) | IP worked very good with this antibody
|
Iram (Verified Customer) (09-18-2025) | Very good quality SCAP antibody
|
Iram (Verified Customer) (08-14-2020) | Nice staining we got in our tissue sections
|
